Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1894

Name

ECT2

Synonym

ARHGEF31;epithelial cell transforming sequence 2 oncogene;ECT2;epithelial cell transforming sequence 2 oncogene

Definition

epithelial cell-transforming sequence 2 oncogene|protein ECT2

Position

3q26.1-q26.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Regulation of RhoA activity;PID Curated;200050

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

1894

Links to all GeneRIF Items

1894

Links to iHOP

1894

Sequence Information

Nucleotide Sequence

>1894 : length: 2652
atggctgaaaatagtgtattaacatccactactgggaggactagcttggcagactcttcc
atttttgattctaaagttactgagatttccaaggaaaacttacttattggatctacttca
tatgtagaagaagagatgcctcagattgaaacaagagtgatattggttcaagaagctgga
aaacaagaagaacttataaaagccttaaaggacattaaagtgggctttgtaaagatggag
tcagtggaagaatttgaaggtttggattctccggaatttgaaaatgtatttgtagtcacg
gactttcaggattctgtctttaatgacctctacaaggctgattgtagagttattggacca
ccagttgtattaaattgttcacaaaaaggagagcctttgccattttcatgtcgcccgttg
tattgtacaagtatgatgaatctagtactatgctttactggatttaggaaaaaagaagaa
ctagtcaggttggtgacattggtccatcacatgggtggagttattcgaaaagactttaat
tcaaaagttacacatttggtggcaaattgtacacaaggagaaaaattcagggttgctgtg
agtctaggtactccaattatgaagccagaatggatttataaagcttgggaaaggcggaat
gaacaggatttctatgcagcagttgatgactttagaaatgaatttaaagttcctccattt
caagattgtattttaagtttcctgggattttcagatgaagagaaaaccaatatggaagaa
atgactgaaatgcaaggaggtaaatatttaccgcttggagatgaaagatgcactcacctt
gtagttgaagagaatatagtaaaagatcttccctttgaaccttcaaagaaactttatgtt
gtcaagcaagagtggttctggggaagcattcaaatggatgcccgagctggagaaactatg
tatttatatgaaaaggcaaatactcctgagctcaagaaatcagtgtcaatgctttctcta
aatacccctaacagcaatcgcaaacgacgtcgtttaaaagaaacacttgctcagctttca
agagagacagacgtgtcaccatttccaccccgtaagcgcccatcagctgagcattccctt
tccatagggtcactcctagatatctccaacacaccagagtctagcattaactatggagac
accccaaagtcttgtactaagtcttctaaaagctccactccagttccttcaaagcagtca
gcaaggtggcaagttgcaaaagagctttatcaaactgaaagtaattatgttaatatattg
gcaacaattattcagttatttcaagtaccattggaagaggaaggacaacgtggtggacct
atccttgcaccagaggagattaagactatttttggtagcatcccagatatctttgatgta
cacactaagataaaggatgatcttgaagaccttatagttaattgggatgagagcaaaagc
attggtgacatttttctgaaatattcaaaagatttggtaaaaacctaccctccctttgta
aacttctttgaaatgagcaaggaaacaattattaaatgtgaaaaacagaaaccaagattt
catgcttttctcaagataaaccaagcaaaaccagaatgtggacggcagagccttgttgaa
cttcttatccgaccagtacagaggttacccagtgttgcattacttttaaatgatcttaag
aagcatacagctgatgaaaatccagacaaaagcactttagaaaaagctattggatcactg
aaggaagtaatgacgcatattaatgaggataagagaaaaacagaagctcaaaagcaaatt
tttgatgttgtttatgaagtagatggatgcccagctaatcttttatcttctcaccgaagc
ttagtacagcgggttgaaacaatttctctaggtgagcacccctgtgacagaggagaacaa
gtaactctcttcctcttcaatgattgcctagagatagcaagaaaacggcacaaggttatt
ggcacttttaggagtcctcatggccaaacccgacccccagcttctcttaagcatattcac
ctaatgcctctttctcagattaagaaggtattggacataagagagacagaagattgccat
aatgcttttgccttgcttgtgaggccaccaacagagcaggcaaatgtgctactcagtttc
cagatgacatcagatgaacttccaaaagaaaactggctaaagatgctgtgtcgacatgta
gctaacaccatttgtaaagcagatgctgagaatcttatttatactgctgatccagaatcc
tttgaagtaaatacaaaagatatggacagtacattgagtagagcatcaagagcaataaaa
aagacttcaaaaaaggttacaagagcattctctttctccaaaactccaaaaagagctctt
cgaagggctcttatgacatcccacggctcagtggagggaagaagtccttccagcaatgat
aagcatgtaatgagtcgtctttctagcacatcatcattagcaggtatcccttctccctcc
cttgtcagccttccttccttctttgaaaggagaagtcatacgttaagtagatctacaact
catttgatatga

Protein Sequence

>1894 : length: 883
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAG
KQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGP
PVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLS
RETDVSPFPPRKRPSAEHSLSIGSLLDISNTPESSINYGDTPKSCTKSSKSSTPVPSKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKETIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQ
VTLFLFNDCLEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCH
NAFALLVRPPTEQANVLLSFQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSND
KHVMSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI



')