Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1839

Name

HBEGF

Synonym

DTR|DTS|DTSF|HEGFL;heparin-binding EGF-like growth factor;HBEGF;heparin-binding EGF-like growth factor

Definition

diphtheria toxin receptor (heparin-binding EGF-like growth factor)|diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor)|heparin-binding epidermal growth factor|proheparin-binding EGF-like growth factor

Position

5q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

ErbB receptor signaling network;PID Curated;200136

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Disease

Retinal disease;FunDO

Disease

Diphtheria, susceptibility to;OMIM

Disease

Brain tumor;FunDO

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Kidney disease;FunDO

Disease

Malignant fibroxanthoma;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

1839

Links to all GeneRIF Items

1839

Links to iHOP

1839

Sequence Information

Nucleotide Sequence

>1839 : length: 627
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagttctctcggcactg
gtgactggcgagagcctggagcggcttcggagagggctagctgctggaaccagcaacccg
gaccctcccactgtatccacggaccagctgctacccctaggaggcggccgggaccggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaaacaaggaggagcacgggaaaagaaagaagaaaggcaagggg
ctagggaagaagagggacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgtcatgggctgagcctcccagtggaaaatcgcttatatacctatgaccacaca
accatcctggccgtggtggctgtggtgctgtcatctgtctgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactaattcccactga

Protein Sequence

>1839 : length: 208
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH



')