Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

182

Name

JAG1

Synonym

AGS|AHD|AWS|CD339|HJ1|JAGL1;jagged 1;JAG1;jagged 1

Definition

protein jagged-1

Position

20p12.1-p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Signaling by Notch;Reactome;REACT:299

Pathway

Angiogenesis;PANTHER;P00005

Disease

Bone Mineral Density;GAD

Disease

METABOLIC;GAD

Disease

Alagille syndrome;OMIM

Disease

Alagille syndrome;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

Prostate cancer;FunDO

Disease

Tetralogy of Fallot;OMIM

Disease

multiple sclerosis;GAD

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

Ovarian cancer;FunDO

Disease

Leukemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Deafness, congenital heart defects, and posterior embryotoxon;OMIM

Disease

Bone mineral density;NHGRI

Disease

Breast cancer;FunDO

Disease

Malignant glioma;FunDO

Disease

Liver cancer;FunDO

Disease

Neoplasm metastasis;FunDO

Disease

Deafness;FunDO

External Links

Links to Entrez Gene

182

Links to all GeneRIF Items

182

Links to iHOP

182

Sequence Information

Nucleotide Sequence

>182 : length: 3657
atgcgttccccacggacgcgcggccggtccgggcgccccctaagcctcctgctcgccctg
ctctgtgccctgcgagccaaggtgtgtggggcctcgggtcagttcgagttggagatcctg
tccatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccgggagaccgcaagtgcacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggctcagggtccacgcct
gtcatcgggggcaacaccttcaacctcaaggccagccgcggcaacgaccgcaaccgcatc
gtgctgcctttcagtttcgcctggccgaggtcctatacgttgcttgtggaggcgtgggat
tccagtaatgacaccgttcaacctgacagtattattgaaaaggcttctcactcgggcatg
atcaaccccagccggcagtggcagacgctgaagcagaacacgggcgttgcccactttgag
tatcagatccgcgtgacctgtgatgactactactatggctttggctgcaataagttctgc
cgccccagagatgacttctttggacactatgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggccccgaatgtaacagagctatttgccgacaaggctgcagtcct
aagcatgggtcttgcaaactcccaggtgactgcaggtgccagtacggctggcaaggcctg
tactgtgataagtgcatcccacacccgggatgcgtccacggcatctgtaatgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgtgacaaagatctcaattactgt
gggactcatcagccgtgtctcaacgggggaacttgtagcaacacaggccctgacaaatat
cagtgttcctgccctgaggggtattcaggacccaactgtgaaattgctgagcacgcctgc
ctctctgatccctgtcacaacagaggcagctgtaaggagacctccctgggctttgagtgt
gagtgttccccaggctggaccggccccacatgctctacaaacattgatgactgttctcct
aataactgttcccacgggggcacctgccaggacctggttaacggatttaagtgtgtgtgc
cccccacagtggactgggaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtaaacgccaaatcctgtaagaatctcattgccagctactactgcgactgtcttccc
ggctggatgggtcagaattgtgacataaatattaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgtgagcctaatccctgccagaacggtgcccagtgc
tacaaccgtgccagtgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgcacgaccccctgtgaagtgattgacagctgcacagtg
gccatggcttccaacgacacacctgaaggggtgcggtatatttcctccaacgtctgtggt
cctcacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcacgggaacatactgccatgaaaatattaatgactgtgagagcaacccttgtagaaac
ggtggcacttgcatcgatggtgtcaactcctacaagtgcatctgtagtgacggctgggag
ggggcctactgtgaaaccaatattaatgactgcagccagaacccctgccacaatgggggc
acgtgtcgcgacctggtcaatgacttctactgtgactgtaaaaatgggtggaaaggaaag
acctgccactcacgtgacagtcagtgtgatgaggccacgtgcaacaacggtggcacctgc
tatgatgagggggatgcttttaagtgcatgtgtcctggcggctgggaaggaacaacctgt
aacatagcccgaaacagtagctgcctgcccaacccctgccataatgggggcacatgtgtg
gtcaacggcgagtcctttacgtgcgtctgcaaggaaggctgggaggggcccatctgtgct
cagaataccaatgactgcagccctcatccctgttacaacagcggcacctgtgtggatgga
gacaactggtaccggtgcgaatgtgccccgggttttgctgggcccgactgcagaataaac
atcaatgaatgccagtcttcaccttgtgcctttggagcgacctgtgtggatgagatcaat
ggctaccggtgtgtctgccctccagggcacagtggtgccaagtgccaggaagtttcaggg
agaccttgcatcaccatggggagtgtgataccagatggggccaaatgggatgatgactgt
aatacctgccagtgcctgaatggacggatcgcctgctcaaaggtctggtgtggccctcga
ccttgcctgctccacaaagggcacagcgagtgccccagcgggcagagctgcatccccatc
ctggacgaccagtgcttcgtccacccctgcactggtgtgggcgagtgtcggtcttccagt
ctccagccggtgaagacaaagtgcacctctgactcctattaccaggataactgtgcgaac
atcacatttacctttaacaaggagatgatgtcaccaggtcttactacggagcacatttgc
agtgaattgaggaatttgaatattttgaagaatgtttccgctgaatattcaatctacatc
gcttgcgagccttccccttcagcgaacaatgaaatacatgtggccatttctgctgaagat
atacgggatgatgggaacccgatcaaggaaatcactgacaaaataatcgatcttgttagt
aaacgtgatggaaacagctcgctgattgctgccgttgcagaagtaagagttcagaggcgg
cctctgaagaacagaacagatttccttgttcccttgctgagctctgtcttaactgtggct
tggatctgttgcttggtgacggccttctactggtgcctgcggaagcggcggaagccgggc
agccacacacactcagcctctgaggacaacaccaccaacaacgtgcgggagcagctgaac
cagatcaaaaaccccattgagaaacatggggccaacacggtccccatcaaggattatgag
aacaagaactccaaaatgtctaaaataaggacacacaattctgaagtagaagaggacgac
atggacaaacaccagcagaaagcccggtttgccaagcagccggcgtacacgctggtagac
agagaagagaagccccccaacggcacgccgacaaaacacccaaactggacaaacaaacag
gacaacagagacttggaaagtgcccagagcttaaaccgaatggagtacatcgtatag

Protein Sequence

>182 : length: 1218
MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV



')