Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

177

Name

AGER

Synonym

RAGE;advanced glycosylation end product-specific receptor;AGER;advanced glycosylation end product-specific receptor

Definition

RAGE isoform NtRAGE-delta|RAGE isoform sRAGE-delta

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Vasculitis;FunDO

Disease

Pulmonary function;NHGRI

Disease

Cardiovascular disease;FunDO

Disease

diabetic retinopathy.;GAD

Disease

Lung cancer;FunDO

Disease

Melanoma;FunDO

Disease

Type 2 Diabetes (Retinopathy);GAD

Disease

Vascular dementia;FunDO

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Neoplasm metastasis;FunDO

Disease

non-small cell lung cancer;GAD

Disease

Neuropathy;FunDO

Disease

Prostate cancer;FunDO

Disease

METABOLIC;GAD

Disease

antioxidant status;GAD

Disease

Pancreas cancer;FunDO

Disease

Infiltrating cancer;FunDO

Disease

Colon cancer;FunDO

Disease

Autoimmune disease;FunDO

Disease

diabetes, type 2;GAD

Disease

Hamman-Rich syndrome;FunDO

Disease

Diabetes mellitus;FunDO

Disease

myocardial infarct stroke, ischemic;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

Squamous cell cancer;FunDO

Disease

Rhabdomyosarcoma;FunDO

Disease

Chondrosarcoma;FunDO

Disease

proteinuria and cardiovascular disease;GAD

Disease

pulmonary function;GAD

Disease

nephropathy in diabetes mellitus;GAD

Disease

Glucose intolerance;FunDO

Disease

RENAL;GAD

External Links

Links to Entrez Gene

177

Links to all GeneRIF Items

177

Links to iHOP

177

Sequence Information

Nucleotide Sequence

>177 : length: 1215
atggcagccggaacagcagttggagcctgggtgctggtcctcagtctgtggggggcagta
gtaggtgctcaaaacatcacagcccggattggcgagccactggtgctgaagtgtaagggg
gcccccaagaaaccaccccagcggctggaatggaaactgaacacaggccggacagaagct
tggaaggtcctgtctccccagggaggaggcccctgggacagtgtggctcgtgtccttccc
aacggctccctcttccttccggctgtcgggatccaggatgaggggattttccggtgccag
gcaatgaacaggaatggaaaggagaccaagtccaactaccgagtccgtgtctaccagatt
cctgggaagccagaaattgtagattctgcctctgaactcacggctggtgttcccaataag
gtggggacatgtgtgtcagagggaagctaccctgcagggactcttagctggcacttggat
gggaagcccctggtgcctaatgagaagggagtatctgtgaaggaacagaccaggagacac
cctgagacagggctcttcacactgcagtcggagctaatggtgaccccagcccggggagga
gatccccgtcccaccttctcctgtagcttcagcccaggccttccccgacaccgggccttg
cgcacagcccccatccagccccgtgtctgggagcctgtgcctctggaggaggtccaattg
gtggtggagccagaaggtggagcagtagctcctggtggaaccgtaaccctgacctgtgaa
gtccctgcccagccctctcctcaaatccactggatgaaggatggtgtgcccttgcccctt
ccccccagccctgtgctgatcctccctgagatagggcctcaggaccagggaacctacagc
tgtgtggccacccattccagccacgggccccaggaaagccgtgctgtcagcatcagcatc
atcgaaccaggcgaggaggggccaactgcaggctctgtgggaggatcagggctgggaact
ctagccctggccctggggatcctgggaggcctggggacagccgccctgctcattggggtc
atcttgtggcaaaggcggcaacgccgaggagaggagaggaaggccccagaaaaccaggag
gaagaggaggagcgtgcagaactgaatcagtcggaggaacctgaggcaggcgagagtagt
actggagggccttga

Protein Sequence

>177 : length: 404
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP



')