Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1655

Name

DDX5

Synonym

G17P1|HLR1|HUMP68|p68;DEAD (Asp-Glu-Ala-Asp) box polypeptide 5;DDX5;DEAD (Asp-Glu-Ala-Asp) box polypeptide 5

Definition

ATP-dependent RNA helicase DDX5|DEAD box protein 5|DEAD box-5|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)|RNA helicase p68|probable ATP-dependent RNA helicase DDX5

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

akap95 role in mitosis and chromosome dynamics;PID BioCarta;100247

Pathway

Direct p53 effectors;PID Curated;200101

Disease

INFECTION;GAD

Disease

Colon cancer;FunDO

Disease

Cancer;FunDO

Disease

Hepatitis C, Chronic;GAD

External Links

Links to Entrez Gene

1655

Links to all GeneRIF Items

1655

Links to iHOP

1655

Sequence Information

Nucleotide Sequence

>1655 : length: 1845
atgtcgggttattcgagtgaccgagaccgcggccgggaccgagggtttggtgcacctcga
tttggaggaagtagggcagggcccttatctggaaagaagtttggaaaccctggggagaaa
ttagttaaaaagaagtggaatcttgatgagctgcctaaatttgagaagaatttttatcaa
gagcaccctgatttggctaggcgcacagcacaagaggtggaaacatacagaagaagcaag
gaaattacagttagaggtcacaactgcccgaagccagttctaaatttttatgaagccaat
ttccctgcaaatgtcatggatgttattgcaagacagaatttcactgaacccactgctatt
caagctcagggatggccagttgctctaagtggattggatatggttggagtggcacagact
ggatctgggaaaacattgtcttatttgcttcctgccattgtccacatcaatcatcagcca
ttcctagagagaggcgatgggcctatttgtttggtgctggcaccaactcgggaactggcc
caacaggtgcagcaagtagctgctgaatattgtagagcatgtcgcttgaagtctacttgt
atctacggtggtgctcctaagggaccacaaatacgtgatttggagagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtggaaaaaccaatctgaga
agaacaacctaccttgtccttgatgaagcagatagaatgcttgatatgggctttgaaccc
caaataaggaagattgtggatcaaataagacctgataggcaaactctaatgtggagtgcg
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatata
aacattggtgcacttgaactgagtgcaaaccacaacattcttcagattgtggatgtgtgt
catgacgtagaaaaggatgaaaaacttattcgtctaatggaagagatcatgagtgagaag
gagaataaaaccattgtttttgtggaaaccaaaagaagatgtgatgagcttaccagaaaa
atgaggagagatgggtggcctgccatgggtatccatggtgacaagagtcaacaagagcgt
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctacagatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttacacctaataacataaagcaagtgagcgaccttatctctgtgctt
cgtgaagctaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggatgaccgtcgggacagatactctgcgggc
aaaaggggtggatttaatacctttagagacagggaaaattatgacagaggttactctagc
ctgcttaaaagagattttggggcaaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtgtctgctggtatacagaccagttttaggact
ggtaatccaacagggacttaccagaatggttatgatagcactcagcaatacggaagtaat
gttccaaatatgcacaatggtatgaaccaacaggcatatgcatatcctgctactgcagct
gcacctatgattggttatccaatgccaacaggatattcccaataa

Protein Sequence

>1655 : length: 614
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAA
APMIGYPMPTGYSQ



')