Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1612

Name

DAPK1

Synonym

DAPK;death-associated protein kinase 1;DAPK1;death-associated protein kinase 1

Definition

DAP kinase 1

Position

9q34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Role of DCC in regulating apoptosis;PID Reactome;500280

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Cancers;KEGG DISEASE

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Gastritis;FunDO

Disease

Cancer;FunDO

Disease

Bladder cancer;KEGG DISEASE;H00022

Disease

Epilepsy;FunDO

Disease

Alzheimer's disease;GAD

Disease

NEUROLOGICAL;GAD

Disease

Bronchial disease;FunDO

External Links

Links to Entrez Gene

1612

Links to all GeneRIF Items

1612

Links to iHOP

1612

Sequence Information

Nucleotide Sequence

>1612 : length: 4293
atgaccgtgttcaggcaggaaaacgtggatgattactacgacaccggcgaggaacttggc
agtggacagtttgcggttgtgaagaaatgccgtgagaaaagcaccggcctccagtatgcc
gccaaattcatcaagaaaaggaggactaagtccagccggcggggtgtgagccgcgaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaatgtcatcaccctgcac
gaggtctatgagaacaagacggacgtcatcctgatcttggaactcgttgcaggtggcgag
ctgtttgacttcttagctgaaaaggaatctttaactgaagaggaagcaactgaatttctc
aaacaaattcttaatggtgtttactacctgcactcccttcaaatcgcccactttgatctt
aagcctgagaacataatgcttttggatagaaatgtccccaaacctcggatcaagatcatt
gactttgggttggcccataaaattgactttggaaatgaatttaaaaacatatttgggact
ccagagtttgtcgctcctgagatagtcaactatgaacctcttggtcttgaggcagatatg
tggagtatcggggtaataacctatatcctcctaagtggggcctccccatttcttggagac
actaagcaagaaacgttagcaaatgtatccgctgtcaactacgaatttgaggatgaatac
ttcagtaataccagtgccctagccaaagatttcataagaagacttctggtcaaggatcca
aagaagagaatgacaattcaagatagtttgcagcatccctggatcaagcctaaagataca
caacaggcacttagtagaaaagcatcagcagtaaacatggagaaattcaagaagtttgca
gcccggaaaaaatggaaacaatccgttcgcttgatatcactgtgccaaagattatccagg
tcattcctgtccagaagtaacatgagtgttgccagaagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaacgatgacaatgtcccaggcctg
cagcaccttctgggctcattatccaactatgatgttaaccaacccaacaagcacgggaca
cctccattactcattgctgctggctgtgggaatattcaaatactacagttgctcattaaa
agaggctcgagaatcgatgtccaggataagggcgggtccaatgccgtctactgggctgct
cggcatggccacgtcgataccttgaaatttctcagtgagaacaaatgccctttggatgtg
aaagacaagtctggagagatggccctccacgtggcagctcgctatggccatgctgacgtg
gctcagttactgtgcagcttcggctcaaatcccaatatccaggacaaggaagaagaaacc
cccctgcactgtgctgcttggcacggctattactctgtggccaaagccctttgtgaagcc
ggctgtaacgtgaacatcaagaaccgagaaggagagacgcccctcctgacagcctctgcc
aggggctaccacgacatcgtggagtgtctggccgaacatggagccgaccttaatgcttgc
gacaaggacggacacattgcccttcatctggctgtaagacggtgtcagatggaggtaatc
aagactctcctcagccaagggtgtttcgtcgattatcaagacaggcacggcaatactccc
ctccatgtggcatgtaaagatggcaacatgcctatcgtggtggccctctgtgaagcaaac
tgcaatttggacatctccaacaagtatgggcgaacgcctctgcaccttgcggccaacaac
ggaatcctagacgtggtccggtatctctgtctgatgggagccagcgttgaggcgctgacc
acggacggaaagacggcagaagatcttgctagatcggaacagcacgagcacgtagcaggt
ctccttgcaagacttcgaaaggatacgcaccgaggactcttcatccagcagctccgaccc
acacagaacctgcagccaagaattaagctcaagctgtttggccactcgggatccgggaaa
accacccttgtagaatctctcaagtgtgggctgctgaggagctttttcagaaggcgtcgg
cccagactgtcttccaccaactccagcaggttcccaccttcacccctggcttctaagccc
acagtctcagtgagcatcaacaacctgtacccaggctgcgagaacgtgagtgtgaggagc
cgcagcatgatgttcgagccgggtcttaccaaagggatgctggaggtgtttgtggccccg
acccaccacccgcactgctcggccgatgaccagtccaccaaggccatcgacatccagaac
gcttatttgaatggagttggcgatttcagcgtgtgggagttctctggaaatcctgtgtat
ttctgctgttatgactattttgctgcaaatgatcccacgtcaatccatgttgttgtcttt
agtctagaagagccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtcccttgtcccagttgaagaacccatagccttcggtggcaagctgaagaacccactc
caagttgtcctggtggccacccacgctgacatcatgaatgttcctcgaccggctggaggc
gagtttggatatgacaaagacacatcgttgctgaaagagattaggaacaggtttggaaat
gatcttcacatttcaaataagctgtttgttctggatgctggggcttctgggtcaaaggac
atgaaggtacttcgaaatcatctgcaagaaatacgaagccagattgtttcggtctgtcct
cccatgactcacctgtgtgagaaaatcatctccacgctgccttcctggaggaagctcaat
ggacccaaccagctgatgtcgctgcagcagtttgtgtacgacgtgcaggaccagctgaac
cccctggccagcgaggaggacctcaggcgcattgctcagcagctccacagcacaggcgag
atcaacatcatgcaaagtgaaacagttcaggacgtgctgctcctggacccccgctggctc
tgcacaaacgtcctggggaagttgctgtccgtggagaccccacgggcgctgcaccactac
cggggccgctacaccgtggaggacatccagcgcctggtgcccgacagcgacgtggaggag
ctgctgcagatcctcgatgccatggacatctgcgcccgggacctgagcagcgggaccatg
gtggacgtcccagccctgatcaagacagacaacctgcaccgctcctgggctgatgaggag
gacgaggtgatggtgtatggtggcgtgcgcatcgtgcccgtggaacacctcacccccttc
ccatgtggcatctttcacaaggtccaggtgaacctgtgccggtggatccaccagcaaagc
acagagggcgacgcggacatccgcctgtgggtgaatggctgcaagctggccaaccgtggg
gccgagctgctggtgctgctggtcaaccacggccagggcattgaggtccaggtccgcggc
ctggagacggagaagatcaagtgctgcctgctgctggactcggtgtgcagcaccattgag
aacgtcatggccaccacgctgccagggctcctgaccgtgaagcattacctgagcccccag
cagctgcgggagcaccatgagcccgtcatgatctaccagccacgggacttcttccgggca
cagactctgaaggaaacctcactgaccaacaccatgggggggtacaaggaaagcttcagc
agcatcatgtgcttcgggtgtcacgacgtctactcacaggccagcctcggcatggacatc
catgcatcagacctgaacctcctcactcggaggaaactgagtcgcctgctggacccgccc
gaccccctggggaaggactggtgccttctcgccatgaacttaggcctccctgacctcgtg
gcaaagtacaacaccagtaacggggctcccaaggatttcctccccagccccctccacgcc
ctgctgcgggaatggaccacctaccctgagagcacagtgggcaccctcatgtccaaactg
agggagctgggtcgccgggatgccgcagactttttgctgaaggcatcctctgtgttcaaa
atcaacctggatggcaatggccaggaggcctatgcctcgagctgcaacagcggcacctct
tacaattccattagctctgttgtatcccggtga

Protein Sequence

>1612 : length: 1430
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR



')