Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1601

Name

DAB2

Synonym

DOC-2|DOC2;disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila);DAB2;disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)

Definition

differentially-expressed protein 2|disabled homolog 2

Position

5p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Membrane Trafficking;Reactome;REACT:11123

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

TGF-beta receptor signaling;PID Curated;200195

Disease

Chronic kidney disease;NHGRI

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

1601

Links to all GeneRIF Items

1601

Links to iHOP

1601

Sequence Information

Nucleotide Sequence

>1601 : length: 2313
atgtctaacgaagtagaaacaagtgcaaccaatggtcagcccgaccaacaggccgcacca
aaagcaccctcaaagaaggaaaaaaagaaaggccctgaaaagacagatgaatatctctta
gcaaggttcaaaggcgatggtgtaaaatataaggccaagctgattggcattgatgatgtg
ccagatgcaagaggggataaaatgagccaagactctatgatgaaactaaagggaatggcg
gcagctggtcggtctcagggacaacacaaacaaaggatctgggtcaacatttccctttct
gggataaaaataattgatgagaaaactggggtaatagagcatgaacatccagtaaataag
atttctttcattgcccgtgatgtgacagacaaccgggcatttggttacgtgtgtggagga
gaaggccagcatcagttttttgccataaaaaccgggcaacaggctgaaccattagttgtt
gatcttaaagacctttttcaagttatctataatgtaaagaaaaaggaagaagaaaagaaa
aagatagaggaagccagcaaagcagttgagaatgggagtgaggccctaatgattctagat
gaccaaactaacaaactgaaatcgggtgttgaccagatggatttgtttggggacatgtct
acacctcctgacctaaatagtccaacagaaagcaaagatatcctgttagtggatctaaac
tctgaaatcgacaccaatcagaattctttaagagaaaatccattcttaacaaacggcatc
acctcctgttctcttcctcgaccaacgcctcaggcatccttcttgcctgaaaatgccttt
tctgccaatctcaacttctttcccacccctaatcctgatcctttccgtgacgatcctttc
acacagccagaccaatcgacaccttcttcgtttgattctctcaaatctccagatcagaag
aaagagaattcgagtagctcgtctactccgctgagtaatgggcccctgaatggtgatgtt
gactactttggtcagcaatttgaccagatctctaaccggactggcaaacaggaagctcag
gcaggcccatggcccttttcaagttcgcaaacccagccagcagtgagaactcaaaatggg
gtatctgaaagagaacagaacggcttctctgtcaaatcctccccgaacccttttgtggga
agccctcccaaaggactgtccatacagaatggcgtaaagcaggacttggaaagctctgtc
cagtcctcaccacatgactccatagccattatcccacctccacaaagtaccaaaccagga
agaggcagaaggactgctaagtcttcagccaatgacttgcttgcatcagacatctttgct
cctcccgtctcagaaccttcaggccaggcgtcacccacaggacaacctacagccctgcag
cccaaccctctggatctcttcaaaacaagtgctcctgccccagtggggcccctggtgggt
ctaggtggtgtaactgtcacactccctcaggcaggaccatggaacacagcatctttggtc
ttcaatcagtccccttcaatggctccgggagccatgatgggtggtcaaccttcaggtttt
agtcagcccgtcatttttggtacaagtccagctgtttcaggttggaaccagccttcaccc
tttgcagcctcaactccccctccagtgcctgttgtctggggcccttctgcatctgtggca
cccaatgcttggtcaacaacaagccctttggggaatccttttcagagcaatatttttcca
gctcctgctgtgtccactcagcccccatccatgcactcctctctcctggtcactcctcct
cagccacctcccagagctggccctcccaaggacatctccagtgatgccttcactgcctta
gacccacttggggataaagagatcaaggatgtgaaagaaatgtttaaggatttccaactg
cggcagccacctgctgtgcccgcgcggaagggagagcagacttcttctgggactttgagt
gcctttgccagttatttcaacagcaaggttggcattcctcaggagaatgcagaccatgat
gactttgatgctaatcaactattgaacaagatcaatgaaccaccaaagccagctcccaga
caagtttccctgccagttaccaaatctactgacaatgcatttgagaaccctttctttaaa
gattcttttggttcatcacaagcctctgtggcttcttctcaacctgtatcttctgagatg
tatagggatccatttggaaatccttttgcctaa

Protein Sequence

>1601 : length: 770
MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLN
SEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPF
TQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQ
AGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQ
PNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGF
SQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFP
APAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQL
RQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPR
QVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA



')