Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1522

Name

CTSZ

Synonym

CTSX;cathepsin Z;CTSZ;cathepsin Z

Definition

cathepsin P|cathepsin X|preprocathepsin P

Position

20q13.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Membrane Trafficking;Reactome;REACT:11123

Pathway

Lysosome;KEGG PATHWAY;hsa04142

Disease

Tuberculosis;FunDO

External Links

Links to Entrez Gene

1522

Links to all GeneRIF Items

1522

Links to iHOP

1522

Sequence Information

Nucleotide Sequence

>1522 : length: 912
atggcgaggcgcgggccagggtggcggccgcttctgctgctcgtgctgctggcgggcgcg
gcgcagggcggcctctacttccgccggggacagacctgctaccggcctctgcggggggac
gggctggctccgctggggcgcagcacatacccccggcctcatgagtacctgtccccagcg
gatctgcccaagagctgggactggcgcaatgtggatggtgtcaactatgccagcatcacc
cggaaccagcacatcccccaatactgcggctcctgctgggcccacgccagcaccagcgct
atggcggatcggatcaacatcaagaggaagggagcgtggccctccaccctcctgtccgtg
cagaacgtcatcgactgcggtaacgctggctcctgtgaagggggtaatgacctgtccgtg
tgggactacgcccaccagcacggcatccctgacgagacctgcaacaactaccaggccaag
gaccaggagtgtgacaagtttaaccaatgtgggacatgcaatgaattcaaagagtgccac
gccatccggaactacaccctctggagggtgggagactacggctccctctctgggagggag
aagatgatggcagaaatctacgcaaatggtcccatcagctgtggaataatggcaacagaa
agactggctaactacaccggaggcatctatgccgaataccaggacaccacatatataaac
catgtcgtttctgtggctgggtggggcatcagtgatgggactgagtactggattgtccgg
aattcatggggtgaaccatggggcgagagaggctggctgaggatcgtgaccagcacctat
aaggatgggaagggcgccagatacaaccttgccatcgaggagcactgtacatttggggac
cccatcgtttaa

Protein Sequence

>1522 : length: 303
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV



')