Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

152189

Name

CMTM8

Synonym

CKLFSF8|CKLFSF8-V2;CKLF-like MARVEL transmembrane domain containing 8;CMTM8;CKLF-like MARVEL transmembrane domain containing 8

Definition

CKLF-like MARVEL transmembrane domain-containing protein 8|chemokine-like factor super family 8|chemokine-like factor superfamily 8|chemokine-like factor superfamily member 8

Position

3p22.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

152189

Links to all GeneRIF Items

152189

Links to iHOP

152189

Sequence Information

Nucleotide Sequence

>152189 : length: 522
atggaggagccgcagcgcgcccgctcgcacacagtcaccaccaccgccagctccttcgca
gagaacttctccaccagcagcagcagcttcgcctacgaccgggagttcctccgcaccctg
cccggcttcctcatcgtggccgagatcgttctggggctgctggtatggacgcttattgct
ggaactgagtacttccgggtccccgcatttggctgggtcatgtttgtagctgtattttac
tgggtcctcaccgtcttcttcctcattatctacataacaatgacctacaccaggattccc
caggtgccctggacaacagtgggcctgtgctttaacggcagtgccttcgtcttgtacctc
tctgccgctgttgtagatgcatcttccgtctcccctgagagggacagtcacaacttcaac
agctgggcggcctcatcgttctttgccttcctggtcaccatctgctacgctggaaataca
tatttcagttttatagcatggagatccaggaccatacagtga

Protein Sequence

>152189 : length: 173
MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIA
GTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYL
SAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ



')