Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

152007

Name

GLIPR2

Synonym

C9orf19|GAPR-1;GLI pathogenesis-related 2;GLIPR2;GLI pathogenesis-related 2

Definition

17kD fetal brain protein|Golgi-associated plant pathogenesis-related protein 1|gliPR 2|glioma pathogenesis-related protein 2|golgi-associated PR-1 protein

Position

9p13.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

152007

Links to all GeneRIF Items

152007

Links to iHOP

152007

Sequence Information

Nucleotide Sequence

>152007 : length: 465
atgggcaagtcagcttccaaacagtttcataatgaggtcctgaaggcccacaatgagtac
cggcagaagcacggcgtccccccactgaagctctgcaagaacctcaaccgggaggctcaa
cagtattctgaggccctggccagcacgaggatcctcaagcacagcccggagtccagccgt
ggccagtgtggggagaaccttgcatgggcatcctatgatcagacaggaaaggaggtggct
gatagatggtacagtgaaatcaagaactataacttccagcagcctggcttcacctcgggg
actggacacttcacggccatggtatggaagaacaccaagaagatgggcgtggggaaggcg
tccgcaagtgacgggtcctcctttgtggtggccagatacttcccagcggggaatgttgtc
aatgagggcttcttcgaagaaaacgtcctgccgccgaagaagtaa

Protein Sequence

>152007 : length: 154
MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSR
GQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKA
SASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK



')