Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1500

Name

CTNND1

Synonym

CAS|CTNND|P120CAS|P120CTN|p120|p120(CAS)|p120(CTN);catenin (cadherin-associated protein), delta 1;CTNND1;catenin (cadherin-associated protein), delta 1

Definition

cadherin-associated Src substrate|catenin delta-1|p120 catenin

Position

11q11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Adherens junctions interactions;PID Reactome;500120

Pathway

Arf6 trafficking events;PID Curated;200046

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

1500

Links to all GeneRIF Items

1500

Links to iHOP

1500

Sequence Information

Nucleotide Sequence

>1500 : length: 2907
atggacgactcagaggtggagtcgaccgccagcatcttggcctctgtgaaggaacaagag
gcccagtttgagaagctgacccgggcgctggaggaggaacggcgccacgtctcggcgcag
ctggaacgcgtccgggtctcaccacaagatgccaacccactcatggccaacggcacactc
acccgccggcatcagaacggccggtttgtgggcgatgctgaccttgaaagacagaaattt
tcagatttgaaactcaacggaccccaggatcacagtcaccttctatatagcaccatcccc
aggatgcaggagccggggcagattgtggagacctacacggaggaggatcctgagggagcc
atgtctgtagtctctgtggagacctcagatgatgggaccactcggcgcacagagaccacg
gtcaagaaagtagtgaagactgtgacaacacggacagtacagccagtcgctatgggacca
gacgggttgcctgtggatgcttcatcagtttctaacaactatatccagactttgggtcgt
gatttccgcaagaatggcaatgggggacctggtccctatgtggggcaagctggcactgct
acccttcctaggaacttccactaccctcctgatggttatagtcgccactatgaagatggt
tatccaggtggcagtgataactatggcagtctgtcccgggtgacccgcattgaggagcgg
tataggcccagcatggaaggctaccgggcacctagtagacaggatgtgtatgggccccaa
ccccaggttcgggtaggtgggagcagcgtggatctgcatcgctttcatccagagccttat
gggctagaggatgaccagcgtagtatgggctatgatgacctggattatggtatgatgtct
gattatggcactgcccgtcggactgggacaccctctgaccctcgtcggcgcctcaggagc
tatgaagacatgattggtgaggaggtgccatcggatcaatactactgggctcctttggcc
cagcatgagcgaggaagtttagcaagcttggatagcctgcgcaaaggagggcctccacct
cctaattggagacagccagagctgccagaggtgatcgccatgcttggattccgcttggat
gctgtcaagtccaatgcagctgcatacctgcaacacttatgctaccgcaatgacaaggtg
aagactgacgtgcggaagctcaagggcatcccagtactggtgggattgttagaccatccc
aaaaaggaagtgcaccttggagcctgtggagctctcaagaatatctcttttggacgtgac
caggataacaagattgccataaaaaactgtgatggtgtgcctgcccttgtgcgattgctt
cgaaaggctcgtgatatggaccttactgaagttattaccggaaccctgtggaatctttca
tcccatgactcaatcaaaatggagattgtggaccatgcactgcatgccttgacagatgaa
gtgatcattcctcattctggttgggagcgggaacctaatgaagactgtaagccacgccat
attgagtgggaatcggtgctcaccaacacagctggctgccttaggaatgtaagctcagag
aggagtgaagctcgccggaaacttcgggaatgtgatggtttagttgatgccctcattttc
attgttcaggctgagattgggcagaaggattcagacagcaagcttgtagagaactgtgtt
tgccttcttcggaacttatcatatcaagttcaccgggagatcccacaggcagagcgttac
caagaggcagctcccaatgttgccaacaatactgggccacatgctgccagttgctttggg
gccaagaagggcaaagatgagtggttctccagagggaaaaaacctatagaggatccagca
aacgatacagtggatttccctaaaagaacgagtccagctcgaggctatgagctcttattt
cagccagaggtggttcggatatacatctcacttcttaaggagagcaagactcctgccatc
ctagaagcctcagctggagctatccagaacttgtgtgctgggcgctggacgtatggtcga
tacatccgctctgctctgcgtcaagagaaggctctttctgccatagctgacctcctgact
aatgaacatgaacgggtggtgaaagctgcatctggagcactgagaaacctggctgtggat
gctcgcaacaaagaattaattggtaaacatgctattcctaacttggtaaagaatctgcca
ggaggacagcagaactcctcttggaatttctctgaggacactgtcatctctattttgaac
actatcaacgaggttatcgctgagaacttggaggctgccaaaaagcttcgagagacacag
ggtattgagaagctggtgttgatcaacaaatcagggaaccgctcagaaaaagaagttcga
gcagcagcacttgtattacagacaatctggggatataaggaactgcggaagccactggaa
aaagaaggatggaagaaatcagactttcaggtgaatctaaacaatgcttcccgaagccag
agcagtcattcatatgatgatagtactctccctctcattgaccggaaccaaaaatcagat
aagaaacctgatcgggaagaaattcagatgagcaatatgggatcaaacacaaaatcacta
gataacaactattccacaccaaatgagagaggagaccacaatagaacactggatcgatcg
ggggatctaggcgacatggagccattgaagggaacaacacccttgatgcaggacgagggg
caggaatctctggaggaagagttggatgtgttggttttggatgatgaggggggccaagtg
tcttacccctccatgcagaagatttag

Protein Sequence

>1500 : length: 968
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTL
TRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGA
MSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS
DYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP
PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLF
QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT
NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN
TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL
DNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV
SYPSMQKI



')