Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1499

Name

CTNNB1

Synonym

CTNNB;catenin (cadherin-associated protein), beta 1, 88kDa;CTNNB1;catenin (cadherin-associated protein), beta 1, 88kDa

Definition

catenin beta-1

Position

3p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Beta-catenin phosphorylation cascade;PID Reactome;500311

Pathway

segmentation clock;PID BioCarta;100146

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Signaling by Wnt;Reactome;REACT:11045

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

E-cadherin signaling events;PID Curated;200094

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Angiogenesis;PANTHER;P00005

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Myogenesis;Reactome;REACT:21303

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

Degradation of beta-catenin by the destruction complex;PID Reactome;500310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Arf6 trafficking events;PID Curated;200046

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Apoptotic cleavage of cell adhesion proteins;PID Reactome;500272

Disease

Colorectal cancer;KEGG DISEASE;H00020

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Aseptic necrosis of bone;FunDO

Disease

Colorectal cancer;OMIM

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Uterine disease;FunDO

Disease

Depression;FunDO

Disease

high exposure to aflatoxin B1.;GAD

Disease

Ulcerative colitis;FunDO

Disease

Bone mineral density (hip);GAD

Disease

Dermatitis;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Alzheimer's disease;FunDO

Disease

Hepatocellular carcinoma;OMIM

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

CANCER;GAD

Disease

Endometrial cancer;KEGG DISEASE;H00026

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Endometriosis;FunDO

Disease

Bone mineral density (hip);NHGRI

Disease

Cancers;KEGG DISEASE

Disease

Hepatoblastoma;OMIM

Disease

Congenital abnormality;FunDO

Disease

Ovarian cancer;OMIM

Disease

Pilomatricoma;OMIM

External Links

Links to Entrez Gene

1499

Links to all GeneRIF Items

1499

Links to iHOP

1499

Sequence Information

Nucleotide Sequence

>1499 : length: 2346
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttacgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

Protein Sequence

>1499 : length: 781
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L



')