Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1490

Name

CTGF

Synonym

CCN2|HCS24|IGFBP8|NOV2;connective tissue growth factor;CTGF;connective tissue growth factor

Definition

CCN family member 2|IBP-8|IGF-binding protein 8|IGFBP-8|hypertrophic chondrocyte-specific protein 24|insulin-like growth factor-binding protein 8

Position

6q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Scleroderma;FunDO

Disease

Muscular dystrophies;FunDO

Disease

Lung cancer;FunDO

Disease

Biliary Atresia;FunDO

Disease

Osteosarcoma;FunDO

Disease

Liver cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Embryoma;FunDO

Disease

Gallbaldder cancer;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Liver disease;FunDO

Disease

Pancreas cancer;FunDO

Disease

Kidney disease;FunDO

Disease

Drug abuse;FunDO

Disease

Fibroid tumor;FunDO

Disease

Proteinuria;FunDO

Disease

Malaria;FunDO

Disease

Brain tumor;FunDO

Disease

Hypertension;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Gouts;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Ovarian cancer;FunDO

Disease

Congenital abnormality;FunDO

External Links

Links to Entrez Gene

1490

Links to all GeneRIF Items

1490

Links to iHOP

1490

Sequence Information

Nucleotide Sequence

>1490 : length: 1050
atgaccgccgccagtatgggccccgtccgcgtcgccttcgtggtcctcctcgccctctgc
agccggccggccgtcggccagaactgcagcgggccgtgccggtgcccggacgagccggcg
ccgcgctgcccggcgggcgtgagcctcgtgctggacggctgcggctgctgccgcgtctgc
gccaagcagctgggcgagctgtgcaccgagcgcgacccctgcgacccgcacaagggcctc
ttctgtgacttcggctccccggccaaccgcaagatcggcgtgtgcaccgccaaagatggt
gctccctgcatcttcggtggtacggtgtaccgcagcggagagtccttccagagcagctgc
aagtaccagtgcacgtgcctggacggggcggtgggctgcatgcccctgtgcagcatggac
gttcgtctgcccagccctgactgccccttcccgaggagggtcaagctgcccgggaaatgc
tgcgaggagtgggtgtgtgacgagcccaaggaccaaaccgtggttgggcctgccctcgcg
gcttaccgactggaagacacgtttggcccagacccaactatgattagagccaactgcctg
gtccagaccacagagtggagcgcctgttccaagacctgtgggatgggcatctccacccgg
gttaccaatgacaacgcctcctgcaggctagagaagcagagccgcctgtgcatggtcagg
ccttgcgaagctgacctggaagagaacattaagaagggcaaaaagtgcatccgtactccc
aaaatctccaagcctatcaagtttgagctttctggctgcaccagcatgaagacataccga
gctaaattctgtggagtatgtaccgacggccgatgctgcaccccccacagaaccaccacc
ctgccggtggagttcaagtgccctgacggcgaggtcatgaagaagaacatgatgttcatc
aagacctgtgcctgccattacaactgtcccggagacaatgacatctttgaatcgctgtac
tacaggaagatgtacggagacatggcatga

Protein Sequence

>1490 : length: 349
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA



')