Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1462

Name

VCAN

Synonym

CSPG2|ERVR|GHAP|PG-M|WGN|WGN1;versican;VCAN;versican

Definition

chondroitin sulfate proteoglycan 2|chondroitin sulfate proteoglycan core protein 2|glial hyaluronate-binding protein|large fibroblast proteoglycan|versican core protein|versican proteoglycan

Position

5q14.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

Endogenous TLR signaling;PID Curated;200177

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Direct p53 effectors;PID Curated;200101

Disease

Pre-Eclampsia;FunDO

Disease

Herpes;FunDO

Disease

Prostate cancer;FunDO

Disease

Intracranial aneurysm;FunDO

Disease

Major depressive disorder;NHGRI

Disease

Endometrium cancer;FunDO

Disease

Melanoma;FunDO

Disease

Spondylarthropathies;FunDO

Disease

Wagner syndrome 1;OMIM

Disease

Metastasis to lymph nodes;FunDO

Disease

Brain tumor;FunDO

Disease

Eating disorder;FunDO

Disease

Breast cancer;FunDO

Disease

Prostatic hypertrophy, Benign;FunDO

Disease

Protein-energy malnutrition;FunDO

External Links

Links to Entrez Gene

1462

Links to all GeneRIF Items

1462

Links to iHOP

1462

Sequence Information

Nucleotide Sequence

>1462 : length: 1968
atgttcataaatataaagagcatcttatggatgtgttcaaccttaatagtaacccatgcg
ctacataaagtcaaagtgggaaaaagcccaccggtgaggggctccctctctggaaaagtc
agcctaccttgtcatttttcaacgatgcctactttgccacccagttacaacaccagtgaa
tttctccgcatcaaatggtctaagattgaagtggacaaaaatggaaaagatttgaaagag
actactgtccttgtggcccaaaatggaaatatcaagattggtcaggactacaaagggaga
gtgtctgtgcccacacatcccgaggctgtgggcgatgcctccctcactgtggtcaagctg
ctggcaagtgatgcgggtctttaccgctgtgacgtcatgtacgggattgaagacacacaa
gacacggtgtcactgactgtggatggggttgtgtttcactacagggcggcaaccagcagg
tacacactgaattttgaggctgctcagaaggcttgtttggacgttggggcagtcatagca
actccagagcagctctttgctgcctatgaagatggatttgagcagtgtgacgcaggctgg
ctggctgatcagactgtcagatatcccatccgggctcccagagtaggctgttatggagat
aagatgggaaaggcaggagtcaggacttatggattccgttctccccaggaaacttacgat
gtgtattgttatgtggatcatctggatggtgatgtgttccacctcactgtccccagtaaa
ttcaccttcgaggaggctgcaaaagagtgtgaaaaccaggatgccaggctggcaacagtg
ggggaactccaggcggcatggaggaacggctttgaccagtgcgattacgggtggctgtcg
gatgccagcgtgcgccaccctgtgactgtggccagggcccagtgtggaggtggtctactt
ggggtgagaaccctgtatcgttttgagaaccagacaggcttccctccccctgatagcaga
tttgatgcctactgctttaaacgacctgatcgctgcaaaatgaacccgtgccttaacgga
ggcacctgttatcctactgaaacttcctacgtatgcacctgtgtgccaggatacagcgga
gaccagtgtgaacttgattttgatgaatgtcactctaatccctgtcgtaatggagccact
tgtgttgatggttttaacacattcaggtgcctctgccttccaagttatgttggtgcactt
tgtgagcaagataccgagacatgtgactatggctggcacaaattccaagggcagtgctac
aaatactttgcccatcgacgcacatgggatgcagctgaacgggaatgccgtctgcagggt
gcccatctcacaagcatcctgtctcacgaagaacaaatgtttgttaatcgtgtgggccat
gattatcagtggataggcctcaatgacaagatgtttgagcatgacttccgttggactgat
ggcagcacactgcaatacgagaattggagacccaaccagccagacagcttcttttctgct
ggagaagactgtgttgtaatcatttggcatgagaatggccagtggaatgatgttccctgc
aattaccatctcacctatacgtgcaagaaaggaacagtcgcttgcggccagccccctgtt
gtagaaaatgccaagacctttggaaagatgaaacctcgttatgaaatcaactccctgatt
agataccactgcaaagatggtttcattcaacgtcaccttccaactatccggtgcttagga
aatggaagatgggctatacctaaaattacctgcatgaacccatctgcataccaaaggact
tattctatgaaatactttaaaaattcctcatcagcaaaggacaattcaataaatacatcc
aaacatgatcatcgttggagccggaggtggcaggagtcgaggcgctga

Protein Sequence

>1462 : length: 655
MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRPDRCKMNPCLNG
GTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGAL
CEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGH
DYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPC
NYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLG
NGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR



')