Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1460

Name

CSNK2B

Synonym

CK2B|CK2N|CSK2B|G5A;casein kinase 2, beta polypeptide;CSNK2B;casein kinase 2, beta polypeptide

Definition

CK II beta|Casein kinase II beta subunit|alternative name: G5a, phosvitin|casein kinase II subunit beta|phosvitin|protein G5a

Position

6p21-p12|6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

Tight junction;KEGG PATHWAY;hsa04530

External Links

Links to Entrez Gene

1460

Links to all GeneRIF Items

1460

Links to iHOP

1460

Sequence Information

Nucleotide Sequence

>1460 : length: 648
atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa
ttcttctgtgaagtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtccctcactaccgacaagctctagacatgatcttggacctggagcctgatgaa
gaactggaagacaaccccaaccagagtgacctgattgagcaggcagccgagatgctttat
ggattgatccacgcccgctacatccttaccaaccgtggcatcgcccagatgttggaaaag
taccagcaaggagactttggttactgtcctcgtgtgtactgtgagaaccagccaatgctt
cccattggcctttcagacatcccaggtgaagccatggtgaagctctactgccccaagtgc
atggatgtgtacacacccaagtcatcaagacaccatcacacggatggcgcctacttcggc
actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagagacctgcc
aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

Protein Sequence

>1460 : length: 215
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR



')