Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1445

Name

CSK

Synonym

-;c-src tyrosine kinase;CSK;c-src tyrosine kinase

Definition

C-Src kinase|protein-tyrosine kinase CYL|tyrosine-protein kinase CSK

Position

15q24.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

T cell activation;PANTHER;P00053

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Parkinson disease;PANTHER;P00049

Pathway

activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

Hemostasis;Reactome;REACT:604

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Phosphorylation of CD3 and TCR zeta chains;PID Reactome;500479

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Integrin alphaIIbbeta3 signaling;PID Reactome;500005

Disease

Prostate cancer;FunDO

Disease

Cystic fibrosis;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Adenovirus infection;FunDO

Disease

Diastolic blood pressure;GAD

Disease

Diastolic blood pressure;NHGRI

Disease

Infiltrating cancer;FunDO

Disease

Colon cancer;FunDO

Disease

Breast cancer;FunDO

External Links

Links to Entrez Gene

1445

Links to all GeneRIF Items

1445

Links to iHOP

1445

Sequence Information

Nucleotide Sequence

>1445 : length: 1353
atgtcagcaatacaggccgcctggccatccggtacagaatgtattgccaagtacaacttc
cacggcactgccgagcaggacctgcccttctgcaaaggagacgtgctcaccattgtggcc
gtcaccaaggaccccaactggtacaaagccaaaaacaaggtgggccgtgagggcatcatc
ccagccaactacgtccagaagcgggagggcgtgaaggcgggtaccaaactcagcctcatg
ccttggttccacggcaagatcacacgggagcaggctgagcggcttctgtacccgccggag
acaggcctgttcctggtgcgggagagcaccaactaccccggagactacacgctgtgcgtg
agctgcgacggcaaggtggagcactaccgcatcatgtaccatgccagcaagctcagcatc
gacgaggaggtgtactttgagaacctcatgcagctggtggagcactacacctcagacgca
gatggactctgtacgcgcctcattaaaccaaaggtcatggagggcacagtggcggcccag
gatgagttctaccgcagcggctgggccctgaacatgaaggagctgaagctgctgcagacc
atcgggaagggggagttcggagacgtgatgctgggcgattaccgagggaacaaagtcgcc
gtcaagtgcattaagaacgacgccactgcccaggccttcctggctgaagcctcagtcatg
acgcaactgcggcatagcaacctggtgcagctcctgggcgtgatcgtggaggagaagggc
gggctctacatcgtcactgagtacatggccaaggggagccttgtggactacctgcggtct
aggggtcggtcagtgctgggcggagactgtctcctcaagttctcgctagatgtctgcgag
gccatggaatacctggagggcaacaatttcgtgcatcgagacctggctgcccgcaatgtg
ctggtgtctgaggacaacgtggccaaggtcagcgactttggtctcaccaaggaggcgtcc
agcacccaggacacgggcaagctgccagtcaagtggacagcccctgaggccctgagagag
aagaaattctccactaagtctgacgtgtggagtttcggaatccttctctgggaaatctac
tcctttgggcgagtgccttatccaagaattcccctgaaggacgtcgtccctcgggtggag
aagggctacaagatggatgcccccgacggctgcccgcccgcagtctatgaagtcatgaag
aactgctggcacctggacgccgccatgcggccctccttcctacagctccgagagcagctt
gagcacatcaaaacccacgagctgcacctgtga

Protein Sequence

>1445 : length: 450
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL



')