Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1432

Name

MAPK14

Synonym

CSBP|CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA;mitogen-activated protein kinase 14;MAPK14;mitogen-activated protein kinase 14

Definition

CSAID-binding protein|Csaids binding protein|MAP kinase 14|MAP kinase Mxi2|MAP kinase p38 alpha|MAX-interacting protein 2|cytokine suppressive anti-inflammatory drug binding protein|cytokine suppressive anti-inflammatory drug-binding protein|mitogen-activ

Position

6p21.3-p21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

regulation of map kinase pathways through dual specificity phosphatases;PID BioCarta;100185

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

p53 pathway;PID Curated;200175

Pathway

il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Rapid glucocorticoid signaling;PID Curated;200090

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Endothelins;PID Curated;200004

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

tsp-1 induced apoptosis in microvascular endothelial cell;PID BioCarta;100010

Pathway

Parkinson disease;PANTHER;P00049

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

B cell activation;PANTHER;P00010

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

S1P2 pathway;PID Curated;200181

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

il-10 anti-inflammatory signaling pathway;PID BioCarta;100134

Pathway

Angiogenesis;PANTHER;P00005

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

Myogenesis;Reactome;REACT:21303

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

JAK/STAT signaling pathway;PANTHER;P00038

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ADP signalling through P2Y purinoceptor 1;PID Reactome;500292

Pathway

the 41bb-dependent immune response;PID BioCarta;100257

Pathway

tnf/stress related signaling;PID BioCarta;100026

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

IL2-mediated signaling events;PID Curated;200082

Disease

Pre-Eclampsia;FunDO

Disease

Ischemia;FunDO

Disease

Heart failure;FunDO

Disease

Tuberculosis;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Dermatitis;FunDO

Disease

Rheumatic fever;FunDO

Disease

Enteritis;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Skin cancer;FunDO

Disease

Severe acute respiratory syndrome;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Cancer;FunDO

Disease

Schistosoma mansonii infection;FunDO

Disease

Endometriosis;FunDO

Disease

HIV infection;FunDO

Disease

Vascular disease;FunDO

External Links

Links to Entrez Gene

1432

Links to all GeneRIF Items

1432

Links to iHOP

1432

Sequence Information

Nucleotide Sequence

>1432 : length: 1083
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

Protein Sequence

>1432 : length: 360
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES



')