Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

142

Name

PARP1

Synonym

ADPRT|ADPRT 1|ADPRT1|PARP|PARP-1|PPOL|pADPRT-1;poly (ADP-ribose) polymerase 1;PARP1;poly (ADP-ribose) polymerase 1

Definition

ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)|ADP-ribosyltransferase NAD(+)|NAD(+) ADP-ribosyltransferase 1|poly (ADP-ribose) polymerase family, member 1|poly [ADP-ribose] polymerase 1|poly(ADP-ribose) polymerase|poly(ADP-ribose) synthetase|

Position

1q41-q42

Gene Type

protein-coding

Pathways and Diseases

Pathway

opposing roles of aif in apoptosis and cell survival;PID BioCarta;100249

Pathway

Base excision repair;KEGG PATHWAY;hsa03410

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189

Pathway

caspase cascade in apoptosis;PID BioCarta;100218

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

FAS signaling pathway;PANTHER;P00020

Disease

CANCER;GAD

Disease

Ischemia;FunDO

Disease

Alzheimer's disease;GAD

Disease

Melanoma;FunDO

Disease

Kaposi sarcoma;FunDO

Disease

glomerulonephritis;GAD

Disease

arthritis;GAD

Disease

Liver cancer;FunDO

Disease

Xeroderma pigmentosum;OMIM

Disease

Werner syndrome;FunDO

Disease

Parkinson disease;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Fanconi's anemia;FunDO

Disease

lung cancer;GAD

Disease

IMMUNE;GAD

Disease

Parkinson's disease;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Leukemia;FunDO

Disease

Asthma;GAD

Disease

NEUROLOGICAL;GAD

Disease

lupus erythematosus;GAD

Disease

rheumatoid arthritis;GAD

Disease

Neoplasms;GAD

Disease

predisposition to cancer;GAD

Disease

METABOLIC;GAD

Disease

Common cold;FunDO

Disease

Ewings sarcoma;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Uterine fibroids;FunDO

Disease

diabetes, type 2;GAD

Disease

Chronic obstructive airway disease;FunDO

Disease

Breast cancer;FunDO

Disease

Renal tubular acidosis;FunDO

Disease

Heart failure;FunDO

Disease

Celiac disease;FunDO

Disease

Pituitary tumor;FunDO

Disease

Kidney tubular necrosis, acute;FunDO

Disease

Lupus;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

142

Links to all GeneRIF Items

142

Links to iHOP

142

Sequence Information

Nucleotide Sequence

>142 : length: 3045
atggcggagtcttcggataagctctatcgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcaccctgacgttgaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagactctgggtgactttgcagcagagtatgccaagtcc
aacagaagtacgtgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatggtggacccggagaagccacagctaggcatgattgaccgctggtaccatcca
ggctgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctacagaggataaagaagccctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaaaggcgatgaggtggatggagtggatgaagtggcg
aagaagaaatctaaaaaagaaaaagacaaggatagtaagcttgaaaaagccctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagctgatggcatggtgttcggtgccctccttccctgcgaggaatgctcgggt
cagctggtcttcaagagcgatgcctattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaaacaggaccgtatattccccccagaa
accagcgcctccgtggcggccacgcctccgccctccacagcctcggctcctgctgctgtg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactctcgggaag
ctgtcccggaacaaggatgaagtgaaggccatgattgagaaactcggggggaagttgacg
gggacggccaacaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcaggagttgttcttagcgcacatcttgtcccct
tggggggcagaggtgaaggcagagcctgttgaagttgtggccccaagagggaagtcaggg
gctgcgctctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccacccttggcctggtg
gacatcgttaaaggaaccaactcctactacaagctgcagcttctggaggacgacaaggaa
aacaggtattggatattcaggtcctggggccgtgtgggtacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacgaagtatcccaaaaagttctacccc
ctggagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagatgatctttgatgtggaa
agtatgaagaaagccatggtggagtatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcatactccatcctcagtgaggtccagcaggcggtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacaatgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggatcccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgttacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgctgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcgcccgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcctg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgatccttcagct
aacattagtctggatggtgtagacgttcctcttgggaccgggatttcatctggtgtgaat
gacacctctctactatataacgagtacattgtctatgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

Protein Sequence

>142 : length: 1014
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW



')