Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1364

Name

CLDN4

Synonym

CPE-R|CPER|CPETR|CPETR1|WBSCR8|hCPE-R;claudin 4;CLDN4;claudin 4

Definition

CPE-receptor|Clostridium perfringens enterotoxin receptor 1|Williams-Beuren syndrome chromosomal region 8 protein|claudin-4

Position

7q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Cell junction organization;Reactome;REACT:20676

External Links

Links to Entrez Gene

1364

Links to all GeneRIF Items

1364

Links to iHOP

1364

Sequence Information

Nucleotide Sequence

>1364 : length: 630
atggcctccatggggctacaggtaatgggcatcgcgctggccgtcctgggctggctggcc
gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt
gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc
cgcgccctcgtcatcatcagcatcatcgtggctgctctgggcgtgctgctgtccgtggtg
gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg
gcgggcgtggtgttcctgttggccggccttatggtgatagtgccggtgtcctggacggcc
cacaacatcatccaagacttctacaatccgctggtggcctccgggcagaagcgggagatg
ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg
ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc
cgctctgctgctgccagcaactacgtgtaa

Protein Sequence

>1364 : length: 209
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV



')