Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1316

Name

KLF6

Synonym

BCD1|CBA1|COPEB|CPBP|GBF|PAC1|ST12|ZF9;Kruppel-like factor 6;KLF6;Kruppel-like factor 6

Definition

B-cell-derived protein 1|GC-rich binding factor|GC-rich sites-binding factor GBF|Krueppel-like factor 6|Kruppel-like zinc finger protein Zf9|core promoter element binding protein|core promoter element-binding protein|proto-oncogene BCD1|protooncogene B-ce

Position

10p15

Gene Type

protein-coding

External Links

Links to Entrez Gene

1316

Links to all GeneRIF Items

1316

Links to iHOP

1316

Sequence Information

Nucleotide Sequence

>1316 : length: 726
atggacgtgctccccatgtgcagcatcttccaggagctccagatcgtgcacgagaccggc
tacttctcggcgctgccgtctctggaggagtactggcaacagacctgcctagagctggaa
cgttacctccagagcgagccctgctatgtttcagcctcagaaatcaaatttgacagccag
gaagatctgtggaccaaaatcattctggctcgggagaaaaaggaggaatccgaactgaag
atatcttccagtcctccagaggacactctcatcagcccgagcttttgttacaacttagag
accaacagcctgaactcagatgtcagcagcgaatcctctgacagctccgaggaactttct
cccacggccaagtttacctccgaccccattggcgaagttttggtcagctcgggaaaattg
agctcctctgtcacctccacgcctccatcttctccggaactgagcagggaaccttctcaa
ctgtggggttgcgtgcccggggagctgccctcgccagggaaggtgcgcagcgggacttcg
gggaagccaggagaaaagccttacagatgctcatgggaagggtgtgagtggcgttttgca
agaagtgatgagttaaccaggcacttccgaaagcacaccggggccaagccttttaaatgc
tcccactgtgacaggtgtttttccaggtctgaccacctggccctgcacatgaagaggcac
ctctga

Protein Sequence

>1316 : length: 241
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ
EDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS
PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS
GKPGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRH
L



')