Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1296

Name

COL8A2

Synonym

FECD|FECD1|PPCD|PPCD2;collagen, type VIII, alpha 2;COL8A2;collagen, type VIII, alpha 2

Definition

collagen VIII, alpha-2 polypeptide|collagen alpha-2(VIII) chain|dJ665N4.1 (collagen type VIII alpha 2)|endothelial collagen

Position

1p34.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Integrin signalling pathway;PANTHER;P00034

Disease

Corneal dystrophy polymorphous posterior, 2;OMIM

Disease

Corneal dystrophy, Fuchs endothelial, 1;OMIM

External Links

Links to Entrez Gene

1296

Links to all GeneRIF Items

1296

Links to iHOP

1296

Sequence Information

Nucleotide Sequence

>1296 : length: 2112
atgctggggactctgacacccctgtcttcgctgctgctgctgctactggtgctggtgctg
gggtgtgggccgcgggcgtcctctggtggcggggccggtggggcggcgggctatgcccca
gtgaagtacatccagcccatgcagaaaggacctgtgggaccgcccttccgtgagggcaaa
ggccagtacctggaaatgcctctaccgctgctgccgatggacctgaagggagagcccggc
ccccctgggaagcccgggcctcggggtccccctggcccccctggcttcccaggaaaacca
ggcatgggaaagccaggactccatgggcagcctggccctgctgggccccctggcttctcc
cggatgggcaaggctggtcccccagggctccctggcaaggtcgggccaccagggcagccg
gggcttcggggggagccaggaatacgaggggaccagggcctccggggacccccaggaccc
cctggcctcccgggcccctcaggcattactatccctggaaaaccaggtgcccaaggggtg
ccagggcccccaggattccagggggaaccagggccccagggggagcctgggcccccaggt
gatcgaggcctcaagggggataatggagtgggccagcccgggctgcctggggccccaggg
caggggggtgcccccggcccccccggcctccctggtccagctggcttaggcaaacctggt
ttggatgggcttcctggggccccaggagacaagggtgagtctgggcctcctggagttcca
ggccccaggggggagccaggagctgtgggcccaaaaggacctcctggagtagacggtgtg
ggagtcccaggggcagcagggttgccaggaccacagggcccatcaggggccaaaggggag
ccagggacccggggcccccctgggctgataggccccactggctatgggatgccaggactg
ccaggccccaagggggacaggggcccagctggggtcccaggactcttgggggacaggggt
gagccaggggaggatggggagccaggggagcagggcccacagggtcttgggggtccccct
ggacttcctgggtctgcagggcttcctggcagacgtgggccccctgggcctaagggtgag
gcagggcctggaggacccccaggagtgcctggcattcgaggtgaccaggggcctagtggc
ctggctgggaaaccaggggtcccaggtgagaggggacttcctggggcccatggaccccct
ggaccaactgggcccaagggtgagccgggtttcacgggtcgccctggaggaccaggggtg
gcaggagccctggggcagaaaggtgacttggggctccctgggcagcctggcctgaggggt
ccctcaggaatcccaggactccagggtccagctggccctattgggccccaaggcctgccg
ggcctgaagggggaaccaggcctgccagggccccctggagaggggagagcaggggaacct
ggcacggctgggcccacggggcccccaggggtccctggctcccctggaatcacgggccct
ccggggcctcccgggcccccgggaccccctggtgcccctggggccttcgatgagactggc
atcgcaggcttgcacctgcccaacggcggtgtggagggtgccgtgctgggcaaggggggc
aagccacagtttgggctgggcgagctgtctgcccatgccacaccggccttcactgcggtg
ctcacctcgcccttccccgcctcgggcatgcccgtgaaatttgaccggactctctacaat
ggccacagcggctacaacccagccactggcatcttcacctgccctgtgggcggcgtctac
tactttgcttaccatgtgcacgtcaagggcaccaacgtgtgggtggccctgtacaagaac
aacgtgccggccacctatacctacgatgagtacaagaagggctacctggaccaggcatct
ggtggggccgtgctccagctgcggcccaacgaccaggtctgggtgcagatgccgtcggac
caggccaacggcctctactccacggagtacatccactcctccttttcaggattcttgctc
tgccccacataa

Protein Sequence

>1296 : length: 703
MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGK
GQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFS
RMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGV
PGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPG
LDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGE
PGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPP
GLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPP
GPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLP
GLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETG
IAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYN
GHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQAS
GGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT



')