Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1295

Name

COL8A1

Synonym

C3orf7;collagen, type VIII, alpha 1;COL8A1;collagen, type VIII, alpha 1

Definition

cell proliferation-inducing protein 41|collagen VIII, alpha-1 polypeptide|collagen alpha-1(VIII) chain|endothelial collagen|smooth muscle cell-expressed and macrophage conditioned medium-induced protein smag-64

Position

3q12.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Integrin signalling pathway;PANTHER;P00034

Disease

Age-related macular degeneration;NHGRI

External Links

Links to Entrez Gene

1295

Links to all GeneRIF Items

1295

Links to iHOP

1295

Sequence Information

Nucleotide Sequence

>1295 : length: 2235
atggctgtgctgcctggccctctgcagctgctgggagtgctgcttaccatttccctgagt
tccatcaggctcattcaggctggtgcctactatgggatcaagccgctgccacctcaaatt
cctcctcagatgccaccacaaattccacaataccagcccctgggtcagcaagtacctcac
atgcctttggccaaagatggccttgccatgggcaaggagatgccccacttgcagtatggc
aaagagtatccacacctaccccaatatatgaaggaaattcaaccggcgccaagaatgggc
aaggaagccgtacccaagaaaggcaaagaaataccattagccagtttacgaggggaacaa
ggtccccgtggagagcctggcccaagaggaccacctgggccccctggtttgccaggtcat
gggatacctggaattaaaggaaaaccagggccacagggatatccaggagttggaaagcca
ggtatgcctggaatgccagggaagccaggagccatgggcatgcctggggcaaaaggagaa
attggacagaaaggggaaattgggcctatggggatcccaggaccacaaggacctccaggg
cctcatggacttcctggcattgggaagccaggtgggccagggttaccagggcaaccagga
ccaaagggtgatcgaggacccaaaggactaccaggacctcaaggccttcggggtcctaaa
ggagacaagggcttcgggatgccaggtgcgccaggtgtaaaggggcctccagggatgcac
ggccctcccggccctgttggactgccaggagtgggcaaaccaggagtgacaggcttccct
gggccccagggccccctgggaaagccaggggctccaggagaacctgggccacaaggccct
attggggtaccgggggttcaaggacctcctgggatacccggaattggaaagccaggccag
gatgggatcccaggccagccaggatttccaggtggcaaaggggagcaaggactgccaggg
ctaccaggacccccaggccttccagggattgggaaaccaggcttcccaggacccaaaggt
gaccggggcatgggaggtgttcctggggctcttggaccaagaggggagaaaggaccaata
ggtgccccaggaatagggggtcctccaggagagccaggcctgcctggaatcccaggtcct
atgggccctccaggtgctattggttttcctggacccaaaggagaaggtgggattgtaggg
ccacaggggccaccaggtcccaagggtgagccagggcttcaaggcttcccaggaaagcca
ggtttccttggtgaagtagggcctcctggcatgaggggtttgccaggtcccatagggccc
aagggggaagctgggcaaaaaggtgtaccaggactccctggtgttccagggcttctcgga
cctaagggagagccaggaatcccaggggatcagggtttacagggccccccaggtatccca
gggattgggggccctagtggccccattggaccacctgggattccaggccccaaaggggag
ccgggcctcccagggccccctgggttccctggtatagggaaacccggagtggcaggactt
catggccccccagggaagcctggtgcccttggtcctcaaggccagcctggccttccagga
cccccaggccctccaggacctccaggacccccagctgtgatgccccctacaccaccaccc
cagggagagtatctgccagatatggggctgggaattgatggcgtgaaacccccccatgcc
tacggggctaagaaaggcaagaatggagggccagcctatgagatgcctgcatttaccgcc
gagctaaccgcacctttcccaccggtgggggccccagtgaagtttaacaaactgctgtat
aacggcagacagaactacaacccgcagacaggcatcttcacctgtgaggtccctggtgtc
tactactttgcataccacgttcactgcaaggggggcaacgtgtgggttgctctattcaag
aacaacgagcccgtgatgtacacgtacgacgagtacaaaaagggcttcctggaccaggca
tctgggagtgcagtgctgctgctcaggcccggagaccgggtgttcctccagatgccctca
gaacaggctgcaggactgtatgccgggcagtatgtccactcctccttttcaggatattta
ttgtatcccatgtaa

Protein Sequence

>1295 : length: 744
MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPH
MPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQ
GPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGE
IGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPK
GDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGP
IGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKG
DRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVG
PQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLG
PKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGL
HGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHA
YGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGV
YYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPS
EQAAGLYAGQYVHSSFSGYLLYPM



')