Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1191

Name

CLU

Synonym

APO-J|APOJ|CLI|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2;clusterin;CLU;clusterin

Definition

aging-associated protein 4|apolipoprotein J|complement cytolysis inhibitor|complement lysis inhibitor|complement-associated protein SP-40,40|ku70-binding protein 1|sulfated glycoprotein 2|testosterone-repressed prostate message 2

Position

8p21-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Hemostasis;Reactome;REACT:604

Disease

Lupus erythematosus;FunDO

Disease

Alzheimer's disease;GAD

Disease

Bladder cancer;FunDO

Disease

Panic disorder;NHGRI

Disease

carotid atherosclerosis;GAD

Disease

Melanoma;FunDO

Disease

Breast cancer;FunDO

Disease

Esophagus cancer;FunDO

Disease

Hypercholesterolemia;FunDO

Disease

Von Hippel-Lindau syndrome;FunDO

Disease

Prostate cancer;FunDO

Disease

Serous cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

panic disorder;GAD

Disease

METABOLIC;GAD

Disease

Kidney disease;FunDO

Disease

Colon cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Larynx cancer;FunDO

Disease

Nephrosis;FunDO

Disease

Pre-Eclampsia;FunDO

Disease

PSYCH;GAD

Disease

Alzheimer's disease;NHGRI

Disease

preeclampsia;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Endometrial cancer;FunDO

Disease

hypertension;GAD

Disease

NEUROLOGICAL;GAD

Disease

Renal Cell cancer;FunDO

Disease

Hypertension;FunDO

Disease

cholesterol, LDL;GAD

Disease

cholesterol;GAD

Disease

Azoospermia;FunDO

Disease

Ovarian cancer;FunDO

Disease

Vascular disease;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

1191

Links to all GeneRIF Items

1191

Links to iHOP

1191

Sequence Information

Nucleotide Sequence

>1191 : length: 1383
atggaggcgtgcaaagactccagaattggaggcatgatgaagactctgctgctgtttgtg
gggctgctgctgacctgggagagtgggcaggtcctgggggaccagacggtctcagacaat
gagctccaggaaatgtccaatcagggaagtaagtacgtcaataaggaaattcaaaatgct
gtcaacggggtgaaacagataaagactctcatagaaaaaacaaacgaagagcgcaagaca
ctgctcagcaacctagaagaagccaagaagaagaaagaggatgccctaaatgagaccagg
gaatcagagacaaagctgaaggagctcccaggagtgtgcaatgagaccatgatggccctc
tgggaagagtgtaagccctgcctgaaacagacctgcatgaagttctacgcacgcgtctgc
agaagtggctcaggcctggttggccgccagcttgaggagttcctgaaccagagctcgccc
ttctacttctggatgaatggtgaccgcatcgactccctgctggagaacgaccggcagcag
acgcacatgctggatgtcatgcaggaccacttcagccgcgcgtccagcatcatagacgag
ctcttccaggacaggttcttcacccgggagccccaggatacctaccactacctgcccttc
agcctgccccaccggaggcctcacttcttctttcccaagtcccgcatcgtccgcagcttg
atgcccttctctccgtacgagcccctgaacttccacgccatgttccagcccttccttgag
atgatacacgaggctcagcaggccatggacatccacttccatagcccggccttccagcac
ccgccaacagaattcatacgagaaggcgacgatgaccggactgtgtgccgggagatccgc
cacaactccacgggctgcctgcggatgaaggaccagtgtgacaagtgccgggagatcttg
tctgtggactgttccaccaacaacccctcccaggctaagctgcggcgggagctcgacgaa
tccctccaggtcgctgagaggttgaccaggaaatacaacgagctgctaaagtcctaccag
tggaagatgctcaacacctcctccttgctggagcagctgaacgagcagtttaactgggtg
tcccggctggcaaacctcacgcaaggcgaagaccagtactatctgcgggtcaccacggtg
gcttcccacacttctgactcggacgttccttccggtgtcactgaggtggtcgtgaagctc
tttgactctgatcccatcactgtgacggtccctgtagaagtctccaggaagaaccctaaa
tttatggagaccgtggcggagaaagcgctgcaggaataccgcaaaaagcaccgggaggag
tga

Protein Sequence

>1191 : length: 460
MEACKDSRIGGMMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNA
VNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMAL
WEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQ
THMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSL
MPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIR
HNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQ
WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKL
FDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE



')