Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

11279

Name

KLF8

Synonym

BKLF3|ZNF741;Kruppel-like factor 8;KLF8;Kruppel-like factor 8

Definition

Krueppel-like factor 8|basic krueppel-like factor 3|basic kruppel-like factor 3|zinc finger protein 741

Position

Xp11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Disease

Embryoma;FunDO

Disease

Mental retardation;FunDO

Disease

Breast cancer;FunDO

Disease

Ovarian cancer;FunDO

External Links

Links to Entrez Gene

11279

Links to all GeneRIF Items

11279

Links to iHOP

11279

Sequence Information

Nucleotide Sequence

>11279 : length: 774
atggtcgatatggataaactcataaacaacttggaggtccaacttaattcagaaggtggc
tcaatgcaggtattcaagcaggtcactgcttctgttcggaacagagatccccctgagata
gaatacagaagtaatatgacttctccaacactcctggatgccaaccccatggagaaccca
gcactgtttaatgacatcaagattgagcccccagaagaacttttggctagtgatttcagc
ctgccccaagtggaaccagttgacctctcctttcacaagcccaaggctcctctccagcct
gctagcatgctacaagctccaatacgtccccccaagccacagtcttctccccagaccctt
gtggtgtccacgtcaacatctgacatgagcacttcagcaaacattcctactgttctgacc
ccaggctctgtcctgacctcctctcagagcactggtagccagcagatcttacatgtcatt
cacactatcccctcagtcagtctgccaaataagatgggtggcctgaagaccatcccagtg
gtagtgcagtctctgcccatggtgtatactactttgcctgcagatgggggccctgcagcc
attacagtcccactcattggaggagatggtaaaaatgctggatcagtgaaagttgacccc
acctccatgtctccactggaaattccaagtgacagtgaggagagtacaattgagagtgga
tcctcagccttgcagagtctgcagggactacagcaagagagagaagccttataa

Protein Sequence

>11279 : length: 257
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENP
ALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTL
VVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPV
VVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESG
SSALQSLQGLQQEREAL



')