Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

11187

Name

PKP3

Synonym

-;plakophilin 3;PKP3;plakophilin 3

Definition

plakophilin 3b|plakophilin-3

Position

11p15

Gene Type

protein-coding

External Links

Links to Entrez Gene

11187

Links to all GeneRIF Items

11187

Links to iHOP

11187

Sequence Information

Nucleotide Sequence

>11187 : length: 2394
atgcaggacggtaacttcctgctgtcggccctgcagcctgaggccggcgtgtgctccctg
gcgctgccctctgacctgcagctggaccgccggggcgccgaggggccggaggccgagcgg
ctgcgggcagcccgcgtccaggagcaggtccgcgcccgcctcttgcagctgggacagcag
ccgcggcacaacggggccgctgagcccgagcctgaggccgagactgccagaggcacatcc
agggggcagtaccacaccctgcaggctggcttcagctctcgctctcagggcctgagtggg
gacaagacctcgggcttccggcccatcgccaagccggcctacagcccagcctcctggtcc
tcccgctccgccgtggatctgagctgcagtcggaggctgagttcagcccacaacgggggc
agcgcctttggggccgctgggtacgggggtgcccagcccacccctcccatgcccaccagg
cccgtgtccttccatgagcgcggtggggttgggagccgggccgactatgacacactctcc
ctgcgctcgctgcggctggggcccgggggcctggacgaccgctacagcctggtgtctgag
cagctggagcccgcggccacctccacctacagggcctttgcgtacgagcgccaggccagc
tccagctccagccgggcaggggggctggactggcccgaggccactgaggtttccccgagc
cggaccatccgtgcccctgccgtgcggaccctgcagcgattccagagcagccaccggagc
cgcggggtaggcggggcagtgccgggggccgtcctggagccagtggctcgagcgccatct
gtgcgcagcctcagcctcagcctggctgactcgggccacctgccggacgtgcatgggttc
aacagctacggtagccaccgaaccctgcagagactcagcagcggttttgatgacattgac
ctgccctcagcagtcaagtacctcatggcttcagaccccaacctgcaggtgctgggagcg
gcctacatccagcacaagtgctacagcgatgcagccgccaagaagcaggcccgcagcctt
caggccgtgcctaggctggtgaagctcttcaaccacgccaaccaggaagtgcagcgccat
gccacaggtgccatgcgcaacctcatctacgacaacgctgacaacaagctggccctggtg
gaggagaacgggatcttcgagctgctgcggacactgcgggagcaggatgatgagcttcgc
aaaaatgtcacagggatcctgtggaacctttcatccagcgaccacctgaaggaccgcctg
gccagagacacgctggagcagctcacagacctggtgttgagccccctgtcgggggctggg
ggtccccccctcatccagcagaacgcctcggaggcggagatcttctacaacgccaccggc
ttcctcaggaacctcagctcagcctctcaggccactcgccagaagatgcgggagtgccac
gggctggtggacgccctggtcacctctatcaaccacgccctggacgcgggcaaatgcgag
gacaagagcgtggagaacgcggtgtgcgtcctgcggaacctgtcctaccgcctctacgac
gagatgccgccgtccgcgctgcagcggctggagggtcgcggccgcagggacctggcgggg
gcgccgccgggagaggtcgtgggctgcttcacgccgcagagccggcggctgcgcgagctg
cccctcgccgccgatgcgctcaccttcgcggaggtgtccaaggaccccaagggcctcgag
tggctgtggagcccccagatcgtggggctgtacaaccggctgctgcagcgctgcgagctc
aaccggcacacgacggaggcggccgccggggcgctgcagaacatcacggcaggcgaccgc
aggtgggcgggggtgctgagccgcctggccctggagcaggagcgtattctgaaccccctg
ctagaccgtgtcaggaccgccgaccaccaccagctgcgctcactgactggcctcatccga
aacctgtctcggaacgctaggaacaaggacgagatgtccacgaaggtggtgagccacctg
atcgagaagctgccgggcagcgtgggtgagaagtcgcccccagccgaggtgctggtcaac
atcatagctgtgctcaacaacctggtggtggccagccccatcgctgcccgagacctgctg
tattttgacggactccgaaagctcatcttcatcaagaagaagcgggacagccccgacagt
gagaagtcctcccgggcagcatccagcctcctggccaacctgtggcagtacaacaagctc
caccgtgacttccgggcgaagggctatcggaaggaggacttcctgggcccatag

Protein Sequence

>11187 : length: 797
MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQ
PRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWS
SRSAVDLSCSRRLSSAHNGGSAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLS
LRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPS
RTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGF
NSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSL
QAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATG
FLRNLSSASQATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYD
EMPPSALQRLEGRGRRDLAGAPPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLE
WLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWAGVLSRLALEQERILNPL
LDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKSPPAEVLVN
IIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSLLANLWQYNKL
HRDFRAKGYRKEDFLGP



')