Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10855

Name

HPSE

Synonym

HPA|HPA1|HPR1|HPSE1|HSE1;heparanase;HPSE;heparanase

Definition

endo-glucoronidase|heparanase-1

Position

4q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Glycosaminoglycan degradation;KEGG PATHWAY;hsa00531

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Disease

Diabetes mellitus;FunDO

Disease

Hodgkin's disease leukemia, myeloid multiple myeloma myelodysplastic syndrome;GAD

Disease

Proteinuria;FunDO

Disease

CANCER;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Stroke;FunDO

Disease

Endometriosis;FunDO

Disease

Aortic aneurysm;FunDO

Disease

Esotropia;FunDO

External Links

Links to Entrez Gene

10855

Links to all GeneRIF Items

10855

Links to iHOP

10855

Sequence Information

Nucleotide Sequence

>10855 : length: 1632
atgctgctgcgctcgaagcctgcgctgccgccgccgctgatgctgctgctcctggggccg
ctgggtcccctctcccctggcgccctgccccgacctgcgcaagcacaggacgtcgtggac
ctggacttcttcacccaggagccgctgcacctggtgagcccctcgttcctgtccgtcacc
attgacgccaacctggccacggacccgcggttcctcatcctcctgggttctccaaagctt
cgtaccttggccagaggcttgtctcctgcgtacctgaggtttggtggcaccaagacagac
ttcctaattttcgatcccaagaaggaatcaacctttgaagagagaagttactggcaatct
caagtcaaccaggatatttgcaaatatggatccatccctcctgatgtggaggagaagtta
cggttggaatggccctaccaggagcaattgctactccgagaacactaccagaaaaagttc
aagaacagcacctactcaagaagctctgtagatgtgctatacacttttgcaaactgctca
ggactggacttgatctttggcctaaatgcgttattaagaacagcagatttgcagtggaac
agttctaatgctcagttgctcctggactactgctcttccaaggggtataacatttcttgg
gaactaggcaatgaacctaacagtttccttaagaaggctgatattttcatcaatgggtcg
cagttaggagaagattttattcaattgcataaacttctaagaaagtccaccttcaaaaat
gcaaaactctatggtcctgatgttggtcagcctcgaagaaagacggctaagatgctgaag
agcttcctgaaggctggtggagaagtgattgattcagttacatggcatcactactatttg
aatggacggactgctaccaaggaagattttctaaaccctgatgtattggacatttttatt
tcatctgtgcaaaaagttttccaggtggttgagagcaccaggcctggcaagaaggtctgg
ttaggagaaacaagctctgcatatggaggcggagcgcccttgctatccgacacctttgca
gctggctttatgtggctggataaattgggcctgtcagcccgaatgggaatagaagtggtg
atgaggcaagtattctttggagcaggaaactaccatttagtggatgaaaacttcgatcct
ttacctgattattggctatctcttctgttcaagaaattggtgggcaccaaggtgttaatg
gcaagcgtgcaaggttcaaagagaaggaagcttcgagtataccttcattgcacaaacact
gacaatccaaggtataaagaaggagatttaactctgtatgccataaacctccataatgtc
accaagtacttgcggttaccctatcctttttctaacaagcaagtggataaataccttcta
agacctttgggacctcatggattactttccaaatctgtccaactcaatggtctaactcta
aagatggtggatgatcaaaccttgccacctttaatggaaaaacctctccggccaggaagt
tcactgggcttgccagctttctcatatagtttttttgtgataagaaatgccaaagttgct
gcttgcatctga

Protein Sequence

>10855 : length: 543
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS
QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL
RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
ACI



')