Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10657

Name

KHDRBS1

Synonym

Sam68|p62|p68;KH domain containing, RNA binding, signal transduction associated 1;KHDRBS1;KH domain containing, RNA binding, signal transduction associated 1

Definition

GAP-associated tyrosine phosphoprotein p62 (Sam68)|KH domain-containing, RNA-binding, signal transduction-associated protein 1|p21 Ras GTPase-activating protein-associated p62|src-associated in mitosis 68 kDa protein

Position

1p32

Gene Type

protein-coding

Pathways and Diseases

Pathway

regulation of splicing through sam68;PID BioCarta;100036

Disease

HIV infection;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

10657

Links to all GeneRIF Items

10657

Links to iHOP

10657

Sequence Information

Nucleotide Sequence

>10657 : length: 1332
atgcagcgccgggacgaccccgccgcgcgcatgagccggtcttcgggccgtagcggctcc
atggacccctccggtgcccacccctcggtgcgtcagacgccgtctcggcagccgccgctg
cctcaccggtcccggggaggcggagggggatcccgcgggggcgcccgggcctcgcccgcc
acgcagccgccaccgctgctgccgccctcggccacgggtcccgacgcgacagtgggcggg
ccagcgccgaccccgctgctgcccccctcggccacagcctcggtcaagatggagccagag
aacaagtacctgcccgaactcatggccgagaaggactcgctcgacccgtccttcactcac
gccatgcagctgctgacggcagaaattgagaagattcagaaaggagactcaaaaaaggat
gatgaggagaattacttggatttattttctcataagaacatgaaactgaaagagcgagtg
ctgatacctgtcaagcagtatcccaagttcaattttgtggggaagattcttggaccacaa
gggaatacaatcaaaagactgcaggaagagactggtgcaaagatctctgtattgggaaag
ggctcaatgagagacaaagccaaggaggaagagctgcgcaaaggtggagaccccaaatat
gcccacttgaatatggatctgcatgtcttcattgaagtctttggacccccatgtgaggct
tatgctcttatggcccatgccatggaggaagtcaagaaatttctagtaccggatatgatg
gatgatatctgtcaggagcaatttctagagctgtcctacttgaatggagtacctgaaccc
tctcgtggacgtggggtgccagtgagaggccggggagctgcacctcctccaccacctgtt
cccaggggccgtggtgttggaccacctcggggggctttggtacgtggtacaccagtaagg
ggagccatcaccagaggtgccactgtgactcgaggcgtgccacccccacctactgtgagg
ggtgctccagcaccaagagcacggacagcgggcatccagaggatacctttgcctccacct
cctgcaccagaaacatatgaagaatatggatatgatgatacatacgcagaacaaagttac
gaaggctacgaaggctattacagccagagtcaaggggactcagaatattatgactatgga
catggggaggttcaagattcttatgaagcttatggccaggacgactggaatgggaccagg
ccgtcgctgaaggcccctcctgctaggccagtgaagggagcatacagagagcacccatat
ggacgttattaa

Protein Sequence

>10657 : length: 443
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPA
TQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPP
PAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY



')