Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10637

Name

LEFTY1

Synonym

LEFTB|LEFTYB;left-right determination factor 1;LEFTY1;left-right determination factor 1

Definition

left-right determination factor B|left-right determination, factor B|protein lefty-1|protein lefty-B

Position

1q42.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

TGF-beta signaling pathway;PANTHER;P00052

External Links

Links to Entrez Gene

10637

Links to all GeneRIF Items

10637

Links to iHOP

10637

Sequence Information

Nucleotide Sequence

>10637 : length: 1101
atgcagcccctgtggctctgctgggcactctgggtgttgcccctggccagccccggggcc
gccctgaccggggagcagctcctgggcagcctgctgcggcagctgcagctcaaagaggtg
cccaccctggacagggccgacatggaggagctggtcatccccacccacgtgagggcccag
tacgtggccctgctgcagcgcagccacggggaccgctcccgcggaaagaggttcagccag
agcttccgagaggtggccggcaggttcctggcgttggaggccagcacacacctgctggtg
ttcggcatggagcagcggctgccgcccaacagcgagctggtgcaggccgtgctgcggctc
ttccaggagccggtccccaaggccgcgctgcacaggcacgggcggctgtccccgcgcagc
gcccgggcccgggtgaccgtcgagtggctgcgcgtccgcgacgacggctccaaccgcacc
tccctcatcgactccaggctggtgtccgtccacgagagcggctggaaggccttcgacgtg
accgaggccgtgaacttctggcagcagctgagccggccccggcagccgctgctgctacag
gtgtcggtgcagagggagcatctgggcccgctggcgtccggcgcccacaagctggtccgc
tttgcctcgcagggggcgccagccgggcttggggagccccagctggagctgcacaccctg
gaccttggggactatggagctcagggcgactgtgaccctgaagcaccaatgaccgagggc
acccgctgctgccgccaggagatgtacattgacctgcaggggatgaagtgggccgagaac
tgggtgctggagcccccgggcttcctggcttatgagtgtgtgggcacctgccggcagccc
ccggaggccctggccttcaagtggccgtttctggggcctcgacagtgcatcgcctcggag
actgactcgctgcccatgatcgtcagcatcaaggagggaggcaggaccaggccccaggtg
gtcagcctgcccaacatgagggtgcagaagtgcagctgtgcctcggatggtgcgctcgtg
ccaaggaggctccagccatag

Protein Sequence

>10637 : length: 366
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQ
YVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP



')