Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10631

Name

POSTN

Synonym

OSF-2|OSF2|PDLPOSTN|PN|RP11-412K4.1|periostin;periostin, osteoblast specific factor;POSTN;periostin, osteoblast specific factor

Definition

osteoblast specific factor 2 (fasciclin I-like)|osteoblast-specific factor 2|periodontal ligament-specific periostin|periostin|periostin isoform thy2|periostin isoform thy4|periostin isoform thy6|periostin isoform thy8

Position

13q13.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

10631

Links to all GeneRIF Items

10631

Links to iHOP

10631

Sequence Information

Nucleotide Sequence

>10631 : length: 2340
atgattccctttttacccatgttttctctactattgctgcttattgttaaccctataaac
gccaacaatcattatgacaagatcttggctcatagtcgtatcaggggtcgggaccaaggc
ccaaatgtctgtgcccttcaacagattttgggcaccaaaaagaaatacttcagcacttgt
aagaactggtataaaaagtccatctgtggacagaaaacgactgtgttatatgaatgttgc
cctggttatatgagaatggaaggaatgaaaggctgcccagcagttttgcccattgaccat
gtttatggcactctgggcatcgtgggagccaccacaacgcagcgctattctgacgcctca
aaactgagggaggagatcgagggaaagggatccttcacttactttgcaccgagtaatgag
gcttgggacaacttggattctgatatccgtagaggtttggagagcaacgtgaatgttgaa
ttactgaatgctttacatagtcacatgattaataagagaatgttgaccaaggacttaaaa
aatggcatgattattccttcaatgtataacaatttggggcttttcattaaccattatcct
aatggggttgtcactgttaattgtgctcgaatcatccatgggaaccagattgcaacaaat
ggtgttgtccatgtcattgaccgtgtgcttacacaaattggtacctcaattcaagacttc
attgaagcagaagatgacctttcatcttttagagcagctgccatcacatcggacatattg
gaggcccttggaagagacggtcacttcacactctttgctcccaccaatgaggcttttgag
aaacttccacgaggtgtcctagaaaggatcatgggagacaaagtggcttccgaagctctt
atgaagtaccacatcttaaatactctccagtgttctgagtctattatgggaggagcagtc
tttgagacgctggaaggaaatacaattgagataggatgtgacggtgacagtataacagta
aatggaatcaaaatggtgaacaaaaaggatattgtgacaaataatggtgtgatccatttg
attgatcaggtcctaattcctgattctgccaaacaagttattgagctggctggaaaacag
caaaccaccttcacggatcttgtggcccaattaggcttggcatctgctctgaggccagat
ggagaatacactttgctggcacctgtgaataatgcattttctgatgatactctcagcatg
gatcagcgcctccttaaattaattctgcagaatcacatattgaaagtaaaagttggcctt
aatgagctttacaacgggcaaatactggaaaccatcggaggcaaacagctcagagtcttc
gtatatcgtacagctgtctgcattgaaaattcatgcatggagaaagggagtaagcaaggg
agaaacggtgcgattcacatattccgcgagatcatcaagccagcagagaaatccctccat
gaaaagttaaaacaagataagcgctttagcaccttcctcagcctacttgaagctgcagac
ttgaaagagctcctgacacaacctggagactggacattatttgtgccaaccaatgatgct
tttaagggaatgactagtgaagaaaaagaaattctgatacgggacaaaaatgctcttcaa
aacatcattctttatcacctgacaccaggagttttcattggaaaaggatttgaacctggt
gttactaacattttaaagaccacacaaggaagcaaaatctttctgaaagaagtaaatgat
acacttctggtgaatgaattgaaatcaaaagaatctgacatcatgacaacaaatggtgta
attcatgttgtagataaactcctctatccagcagacacacctgttggaaatgatcaactg
ctggaaatacttaataaattaatcaaatacatccaaattaagtttgttcgtggtagcacc
ttcaaagaaatccccgtgactgtctataagccaattattaaaaaatacaccaaaatcatt
gatggagtgcctgtggaaataactgaaaaagagacacgagaagaacgaatcattacaggt
cctgaaataaaatacactaggatttctactggaggtggagaaacagaagaaactctgaag
aaattgttacaagaagaggtcaccaaggtcaccaaattcattgaaggtggtgatggtcat
ttatttgaagatgaagaaattaaaagactgcttcagggagacacacccgtgaggaagttg
caagccaacaaaaaagttcaaggatctagaagacgattaagggaaggtcgttctcagtga

Protein Sequence

>10631 : length: 779
MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTC
KNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDAS
KLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLK
NGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDF
IEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHL
IDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQG
RNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDA
FKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGST
FKEIPVTVYKPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLK
KLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ



')