Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10630

Name

PDPN

Synonym

AGGRUS|GP36|GP40|Gp38|HT1A-1|OTS8|PA2.26|T1A|T1A-2;podoplanin;PDPN;podoplanin

Definition

PA2.26 antigen|T1-alpha|glycoprotein 36|glycoprotein, 36-KD|hT1alpha-1|hT1alpha-2|lung type I cell membrane associated glycoprotein|lung type-I cell membrane-associated glycoprotein (T1A-2)

Position

1p36.21

Gene Type

protein-coding

External Links

Links to Entrez Gene

10630

Links to all GeneRIF Items

10630

Links to iHOP

10630

Sequence Information

Nucleotide Sequence

>10630 : length: 363
atgccaggtgccgaagatgatgtggtgactccaggaaccagcgaagaccgctataagtct
ggcttgacaactctggtggcaacaagtgtcaacagtgtaacaggcattcgcatcgaggat
ctgccaacttcagaaagcacagtccacgcgcaagaacaaagtccaagcgccacagcctca
aacgtggccaccagtcactccacggagaaagtggatggagacacacagacaacagttgag
aaagatggtttgtcaacagtgaccctggttggaatcatagttggggtcttactagccatc
ggcttcattggtgcaatcatcgttgtggttatgcgaaaaatgtcgggaaggtactcgccc
taa

Protein Sequence

>10630 : length: 120
MPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATAS
NVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP



')