Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10628

Name

TXNIP

Synonym

EST01027|HHCPA78|THIF|VDUP1;thioredoxin interacting protein;TXNIP;thioredoxin interacting protein

Definition

thioredoxin binding protein 2|thioredoxin-binding protein 2|thioredoxin-interacting protein|upregulated by 1,25-dihydroxyvitamin D-3|vitamin D3 up-regulated protein 1

Position

1q21.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

10628

Links to all GeneRIF Items

10628

Links to iHOP

10628

Sequence Information

Nucleotide Sequence

>10628 : length: 1176
atggtgatgttcaagaagatcaagtcttttgaggtggtctttaacgaccctgaaaaggtg
tacggcagtggcgagaaggtggctggccgggtgatagtggaggtgtgtgaagttactcgt
gtcaaagccgttaggatcctggcttgcggagtggctaaagtgctttggatgcagggatcc
cagcagtgcaaacagacttcggagtacctgcgctatgaagacacgcttcttctggaagac
cagccaacaggtgagaatgagatggtgatcatgagacctggaaacaaatatgagtacaag
ttcggctttgagcttcctcaggggcctctgggaacatccttcaaaggaaaatatgggtgt
gtagactactgggtgaaggcttttcttgaccgcccgagccagccaactcaagagacaaag
aaaaactttgaagtagtggatctggtggatgtcaatacccctgatttaatggcacctgtg
tctgctaaaaaagaaaagaaagtttcctgcatgttcattcctgatgggcgggtgtctgtc
tctgctcgaattgacagaaaaggattctgtgaaggtgatgagatttccatccatgctgac
tttgagaatacatgttcccgaattgtggtccccaaagctgccattgtggcccgccacact
taccttgccaatggccagaccaaggtgctgactcagaagttgtcatcagtcagaggcaat
catattatctcagggacatgcgcatcatggcgtggcaagagccttcgggttcagaagatc
aggccttctatcctgggctgcaacatccttcgagttgaatattccttactgatctatgtt
agcgttcctggatccaagaaggtcatccttgacctgcccctggtaattggcagcagatca
ggtctaagcagcagaacatccagcatggccagccgaaccagctctgagatgagttgggta
gatctgaacatccctgataccccagaagctcctccctgctatatggatgtcattcctgaa
gatcaccgattggagagcccaaccactcctctgctagatgacatggatggctctcaagac
agccctatctttatgtatgcccctgagttcaagttcatgccaccaccgacttatactgag
gtggatccctgcatcctcaacaacaatgtgcagtga

Protein Sequence

>10628 : length: 391
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ



')