Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10516

Name

FBLN5

Synonym

ARMD3|DANCE|EVEC|FIBL-5|UP50;fibulin 5;FBLN5;fibulin 5

Definition

developmental arteries and neural crest EGF-like protein|fibulin-5|urine p50 protein

Position

14q32.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

10516

Links to all GeneRIF Items

10516

Links to iHOP

10516

Sequence Information

Nucleotide Sequence

>10516 : length: 1347
atgccaggaataaaaaggatactcactgttaccattctggctctctgtcttccaagccct
gggaatgcacaggcacagtgcacgaatggctttgacctggatcgccagtcaggacagtgt
ttagatattgatgaatgccgaaccatccccgaggcctgccgaggagacatgatgtgtgtt
aaccaaaatggcgggtatttatgcattccccggacaaaccctgtgtatcgagggccctac
tcgaacccctactcgaccccctactcaggtccgtacccagcagctgccccaccactctca
gctccaaactatcccacgatctccaggcctcttatatgccgctttggataccagatggat
gaaagcaaccaatgtgtggatgtggacgagtgtgcaacagattcccaccagtgcaacccc
acccagatctgcatcaatactgaaggcgggtacacctgctcctgcaccgacggatattgg
cttctggaaggccagtgcttagacattgatgaatgtcgctatggttactgccagcagctc
tgtgcgaatgttcctggatcctattcttgtacatgcaaccctggttttaccctcaatgag
gatggaaggtcttgccaagatgtgaacgagtgtgccaccgagaacccctgcgtgcaaacc
tgcgtcaacacctacggctctttcatctgccgctgtgacccaggatatgaacttgaggaa
gatggcgttcattgcagtgatatggacgagtgcagcttctctgagttcctctgccaacat
gagtgtgtgaaccagcccggcacatacttctgctcctgccctccaggctacatcctgctg
gatgacaaccgaagctgccaagacatcaacgaatgtgagcacaggaaccacacgtgcaac
ctgcagcagacgtgctacaatttacaagggggcttcaaatgcattgaccccatccgctgt
gaggagccttatctgaggatcagtgataaccgctgtatgtgtcctgctgagaaccctggc
tgcagagaccagccctttaccatcttgtaccgggacatggacgtggtgtcaggacgctcc
gttcccgctgacatcttccaaatgcaagccacgacccgctaccctggggcctattacatt
ttccagatcaaatctgggaatgagggcagagaattttacatgcggcaaacgggccccatc
agtgccaccctggtgatgacacgccccatcaaagggccccgggaaatccagctggacttg
gaaatgatcactgtcaacactgtcatcaacttcagaggcagctccgtgatccgactgcgg
atatatgtgtcgcagtacccattctga

Protein Sequence

>10516 : length: 448
MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEE
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCN
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF



')