Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10454

Name

TAB1

Synonym

3'-Tab1|MAP3K7IP1;TGF-beta activated kinase 1/MAP3K7 binding protein 1;TAB1;TGF-beta activated kinase 1/MAP3K7 binding protein 1

Definition

TAK1-binding protein 1|TGF-beta-activated kinase 1 and MAP3K7-binding protein 1|mitogen-activated protein kinase kinase kinase 7-interacting protein 1|transforming growth factor beta-activated kinase-binding protein 1

Position

22q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

TRAF6 Mediated Induction of the antiviral cytokine IFN-alpha/beta cascade;PID Reactome;500449

Disease

Breast cancer;FunDO

External Links

Links to Entrez Gene

10454

Links to all GeneRIF Items

10454

Links to iHOP

10454

Sequence Information

Nucleotide Sequence

>10454 : length: 1515
atggcggcgcagaggaggagcttgctgcagagtgagcagcagccaagctggacagatgac
ctgcctctctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctatgatggcaaccgagtgaccaacttcgtg
gcccagcggctgtccgcagagctcctgctgggccagctgaatgccgagcacgccgaggcc
gatgtgcggcgtgtgctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgacgacgccttggctgagaaggcaagcctccagtcgcaattgccagagggagtccct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgttagagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgtctttcgcag
ctgggcttggatgctggaaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggttaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaatccatggggcacagccgctggatggg
gtgacgggcttcttggtgctgatgtcggaggggttgtacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggagattgctgcgatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtcgtggaccgggtgaagcgcatccacagcgac
accttcgccagtggtggggagcgtgccaggttctgcccccggcacgaggacatgaccctg
ctagtgaggaactttggctacccgctgggcgaaatgagccagcccacaccgagcccagcc
ccagctgcaggaggacgagtgtaccctgtgtctgtgccatactccagcgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagtgcttccaccctggacgaagccacccccaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctctgacggaggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggacggtcgtgttgagccc
tatgtggactttgctgagttttaccgcctctggagcgtggaccatggcgagcagagcgtg
gtgacagcaccgtag

Protein Sequence

>10454 : length: 504
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP



')