Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10413

Name

YAP1

Synonym

YAP|YAP2|YAP65|YKI;Yes-associated protein 1;YAP1;Yes-associated protein 1

Definition

65 kDa Yes-associated protein|yes-associated protein 2|yes-associated protein beta|yes-associated protein delta|yorkie homolog

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

ErbB4 signaling events;PID Curated;200009

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

10413

Links to all GeneRIF Items

10413

Links to iHOP

10413

Sequence Information

Nucleotide Sequence

>10413 : length: 1515
atggatcccgggcagcagccgccgcctcaaccggccccccagggccaagggcagccgcct
tcgcagcccccgcaggggcagggcccgccgtccggacccgggcaaccggcacccgcggcg
acccaggcggcgccgcaggcaccccccgccgggcatcagatcgtgcacgtccgcggggac
tcggagaccgacctggaggcgctcttcaacgccgtcatgaaccccaagacggccaacgtg
ccccagaccgtgcccatgaggctccggaagctgcccgactccttcttcaagccgccggag
cccaaatcccactcccgacaggccagtactgatgcaggcactgcaggagccctgactcca
cagcatgttcgagctcattcctctccagcttctctgcagttgggagctgtttctcctggg
acactgacccccactggagtagtctctggcccagcagctacacccacagctcagcatctt
cgacagtcttcttttgagatacctgatgatgtacctctgccagcaggttgggagatggca
aagacatcttctggtcagagatacttcttaaatcacatcgatcagacaacaacatggcag
gaccccaggaaggccatgctgtcccagatgaacgtcacagcccccaccagtccaccagtg
cagcagaatatgatgaactcggcttcaggtcctcttcctgatggatgggaacaagccatg
actcaggatggagaaatttactatataaaccataagaacaagaccacctcttggctagac
ccaaggcttgaccctcgttttgccatgaaccagagaatcagtcagagtgctccagtgaaa
cagccaccacccctggctccccagagcccacagggaggcgtcatgggtggcagcaactcc
aaccagcagcaacagatgcgactgcagcaactgcagatggagaaggagaggctgcggctg
aaacagcaagaactgcttcggcaggcaatgcggaatatcaatcccagcacagcaaattct
ccaaaatgtcaggagttagccctgcgtagccagttaccaacactggagcaggatggtggg
actcaaaatccagtgtcttctcccgggatgtctcaggaattgagaacaatgacgaccaat
agctcagatcctttccttaacagtggcacctatcactctcgagatgagagtacagacagt
ggactaagcatgagcagctacagtgtccctcgaaccccagatgacttcctgaacagtgtg
gatgagatggatacaggtgatactatcaaccaaagcaccctgccctcacagcagaaccgt
ttcccagactaccttgaagccattcctgggacaaatgtggaccttggaacactggaagga
gatggaatgaacatagaaggagaggagctgatgccaagtctgcaggaagctttgagttct
gacatccttaatgacatggagtctgttttggctgccaccaagctagataaagaaagcttt
cttacatggttatag

Protein Sequence

>10413 : length: 504
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG
TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
DILNDMESVLAATKLDKESFLTWL



')