Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10397

Name

NDRG1

Synonym

CAP43|CMT4D|DRG1|GC4|HMSNL|NDR1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5;N-myc downstream regulated 1;NDRG1;N-myc downstream regulated 1

Definition

DRG-1|N-myc downstream-regulated gene 1 protein|differentiation-related gene 1 protein|nickel-specific induction protein Cap43|protein NDRG1|protein regulated by oxygen-1|reducing agents and tunicamycin-responsive protein|tunicamycin-responsive protein

Position

8q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Disease

Charcot-Marie-Tooth disease;FunDO

Disease

Cancer;FunDO

Disease

Charcot-Marie-Tooth disease, type 4D;OMIM

External Links

Links to Entrez Gene

10397

Links to all GeneRIF Items

10397

Links to iHOP

10397

Sequence Information

Nucleotide Sequence

>10397 : length: 1185
atgtctcgggagatgcaggatgtagacctcgctgaggtgaagcctttggtggagaaaggg
gagaccatcaccggcctcctgcaagagtttgatgtccaggagcaggacatcgagacttta
catggctctgttcacgtcacgctgtgtgggactcccaagggaaaccggcctgtcatcctc
acctaccatgacatcggcatgaaccacaaaacctgctacaaccccctcttcaactacgag
gacatgcaggagatcacccagcactttgccgtctgccacgtggacgcccctggccagcag
gacggcgcagcctccttccccgcagggtacatgtacccctccatggatcagctggctgaa
atgcttcctggagtccttcaacagtttgggctgaaaagcattattggcatgggaacagga
gcaggcgcctacatcctaactcgatttgctctaaacaaccctgagatggtggagggcctt
gtccttatcaacgtgaacccttgtgcggaaggctggatggactgggccgcctccaagatc
tcaggatggacccaagctctgccggacatggtggtgtcccacctttttgggaaggaagaa
atgcagagtaacgtggaagtggtccacacctaccgccagcacattgtgaatgacatgaac
cccggcaacctgcacctgttcatcaatgcctacaacagccggcgcgacctggagattgag
cgaccaatgccgggaacccacacagtcaccctgcagtgccctgctctgttggtggttggg
gacagctcgcctgcagtggatgccgtggtggagtgcaactcaaaattggacccaacaaag
accactctcctcaagatggcggactgtggcggcctcccgcagatctcccagccggccaag
ctcgctgaggccttcaagtacttcgtgcagggcatgggatacatgccctcggctagcatg
acccgcctgatgcggtcccgcacagcctctggttccagcgtcacttctctggatggcacc
cgcagccgctcccacaccagcgagggcacccgaagccgctcccacaccagcgagggcacc
cgcagccgctcgcacaccagcgagggggcccacctggacatcacccccaactcgggtgct
gctgggaacagcgccgggcccaagtccatggaggtctcctgctag

Protein Sequence

>10397 : length: 394
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVIL
TYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAE
MLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKI
SGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIE
RPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGT
RSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC



')