Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1029

Name

CDKN2A

Synonym

ARF|CDK4I|CDKN2|CMM2|INK4|INK4A|MLM|MTS-1|MTS1|P14|P14ARF|P16|P16-INK4A|P16INK4|P16INK4A|P19|P19ARF|TP16;cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4);CDKN2A;cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)

Definition

CDK4 inhibitor p16-INK4|cell cycle negative regulator beta|cyclin-dependent kinase 4 inhibitor A|cyclin-dependent kinase inhibitor 2A|multiple tumor suppressor 1

Position

9p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

C-MYC pathway;PID Curated;200093

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

p53 pathway;PID Curated;200175

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

esophageal squamous cell carcinoma;GAD

Disease

familial melanoma;GAD

Disease

Oral cancer;FunDO

Disease

Eating disorder;FunDO

Disease

Diabetes;KEGG DISEASE

Disease

Skin cancers;KEGG DISEASE

Disease

Osteosarcoma;KEGG DISEASE;H00036

Disease

Viral infections;KEGG DISEASE

Disease

Hamman-Rich syndrome;FunDO

Disease

Non-small cell lung cancer;KEGG DISEASE;H00014

Disease

Orolaryngeal cancer, multiple;OMIM

Disease

Bladder cancer;KEGG DISEASE;H00022

Disease

Stroke;GAD

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Li-Fraumeni syndrome;OMIM

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Hypertension;FunDO

Disease

Malignant melanoma;KEGG DISEASE;H00038

Disease

Burkitt lymphoma;KEGG DISEASE;H00008

Disease

Nasopharyngeal cancer;KEGG DISEASE;H00054

Disease

Abdominal aortic aneurysm;NHGRI

Disease

Type II diabetes mellitus;KEGG DISEASE;H00409

Disease

Cancer;FunDO

Disease

Adult T-cell leukemia;KEGG DISEASE;H00009

Disease

myocardial infarct;GAD

Disease

Pancreatic cancer;KEGG DISEASE;H00019

Disease

overall effect;GAD

Disease

Coronary heart disease;NHGRI

Disease

Infections caused by retro-transcribing viruses;KEGG DISEASE

Disease

Ulcerative colitis;FunDO

Disease

Herpes;FunDO

Disease

oligodendrogliomas;GAD

Disease

hypertension;GAD

Disease

Emphysema;FunDO

Disease

Pancreatitis;FunDO

Disease

coronary heart disease;GAD

Disease

Pancreatic cancer/melanoma syndrome;OMIM

Disease

Kidney disease;FunDO

Disease

Cirrhosis;FunDO

Disease

Myocardial infarction;NHGRI

Disease

Breast cancer;NHGRI

Disease

Coronary Disease;GAD

Disease

melanoma;GAD

Disease

Glioma;GAD

Disease

Papillomavirus infection;FunDO

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

Myocardial infarction (early onset);NHGRI

Disease

Type 2 diabetes;NHGRI

Disease

AGING;GAD

Disease

type 2 diabetes;GAD

Disease

adult T-cell leukemia;GAD

Disease

Adrenal gland hyperfunction;FunDO

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

breast cancer melanoma;GAD

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

Disease

diabetes, type 2;GAD

Disease

Coronary Artery Disease;GAD

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

Adenovirus infection;FunDO

Disease

lung carcinoma;GAD

Disease

Laryngeal cancer;KEGG DISEASE;H00055

Disease

Squamous cell carcinoma;KEGG DISEASE;H00040

Disease

Cancers;KEGG DISEASE

Disease

Metabolic diseases;KEGG DISEASE

Disease

non-small cell lung carcinoma;GAD

Disease

Congenital abnormality;FunDO

Disease

ovarian cancer;GAD

Disease

Esophageal cancer;KEGG DISEASE;H00017

Disease

Protein-energy malnutrition;FunDO

Disease

Cholangiocarcinoma;KEGG DISEASE;H00046

Disease

Malignant islet cell carcinoma;KEGG DISEASE;H00045

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Intracranial aneurysm;NHGRI

Disease

physical function;GAD

Disease

Chronic myeloid leukemia (CML);KEGG DISEASE;H00004

Disease

bladder cancer;GAD

Disease

Parkinson disease;FunDO

Disease

Actinic keratosis;FunDO

Disease

Glioma;NHGRI

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

pancreatic cancer;GAD

Disease

Melanoma;NHGRI

Disease

Diabetes mellitus;FunDO

Disease

Melanoma and neural system tumor syndrome;OMIM

Disease

Neurofibromatosis 1;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

Myocardial Infarction;GAD

Disease

Endometriosis;FunDO

Disease

Gallbladder cancer;KEGG DISEASE;H00047

Disease

Melanoma, cutaneous malignant, 2;OMIM

Disease

NEUROLOGICAL;GAD

Disease

myocardial infarction (early onset);GAD

Disease

Glioma;KEGG DISEASE;H00042

Disease

Intracranial Aneurysm;GAD

Disease

Barrett's esophagus;FunDO

Disease

Head and neck cancers;KEGG DISEASE

External Links

Links to Entrez Gene

1029

Links to all GeneRIF Items

1029

Links to iHOP

1029

Sequence Information

Nucleotide Sequence

>1029 : length: 471
atggagccggcggcggggagcagcatggagccttcggctgactggctggccacggccgcg
gcccggggtcgggtagaggaggtgcgggcgctgctggaggcgggggcgctgcccaacgca
ccgaatagttacggtcggaggccgatccaggtcatgatgatgggcagcgcccgagtggcg
gagctgctgctgctccacggcgcggagcccaactgcgccgaccccgccactctcacccga
cccgtgcacgacgctgcccgggagggcttcctggacacgctggtggtgctgcaccgggcc
ggggcgcggctggacgtgcgcgatgcctggggccgtctgcccgtggacctggctgaggag
ctgggccatcgcgatgtcgcacggtacctgcgcgcggctgcggggggcaccagaggcagt
aaccatgcccgcatagatgccgcggaaggtccctcagacatccccgattga

Protein Sequence

>1029 : length: 156
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD



')