Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1027

Name

CDKN1B

Synonym

CDKN4|KIP1|MEN1B|MEN4|P27KIP1;cyclin-dependent kinase inhibitor 1B (p27, Kip1);CDKN1B;cyclin-dependent kinase inhibitor 1B (p27, Kip1)

Definition

cyclin-dependent kinase inhibitor 1B

Position

12p13.1-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

cdk regulation of dna replication;PID BioCarta;100110

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Cyclin E associated events during G1/S transition;PID Reactome;500877

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087

Disease

Coronary Restenosis;GAD

Disease

overall effect;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Ulcerative colitis;FunDO

Disease

endometriosis;GAD

Disease

prostate cancer;GAD

Disease

head and neck cancer;GAD

Disease

Coronary Artery Disease;GAD

Disease

Hyperparathyroidism;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Proteinuria;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Multiple endocrine neoplasia;FunDO

Disease

CANCER;GAD

Disease

Adenovirus infection;FunDO

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Multiple endocrine neoplasia, type IV;OMIM

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

breast cancer;GAD

Disease

Testicular dysfunction;FunDO

Disease

Prostate cancer;KEGG DISEASE;H00024

Disease

ovarian cancer;GAD

Disease

myocardial infarct;GAD

External Links

Links to Entrez Gene

1027

Links to all GeneRIF Items

1027

Links to iHOP

1027

Sequence Information

Nucleotide Sequence

>1027 : length: 597
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

Protein Sequence

>1027 : length: 198
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT



')