Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

1012

Name

CDH13

Synonym

CDHH|P105;cadherin 13, H-cadherin (heart);CDH13;cadherin 13, H-cadherin (heart)

Definition

H-cadherin|T-cad|T-cadherin|cadherin-13|heart cadherin

Position

16q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Disease

Height;NHGRI

Disease

attention-deficit hyperactivity disorder;GAD

Disease

PSYCH;GAD

Disease

ADHD;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

Attention deficit hyperactivity disorder;NHGRI

Disease

Hypertension;NHGRI

Disease

CARDIOVASCULAR;GAD

Disease

Response to antipsychotic treatment;NHGRI

Disease

response to antipsychotic treatment;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Depression--quantitative trait;NHGRI

Disease

blood pressure;GAD

Disease

Blood pressure;NHGRI

Disease

hypertension;GAD

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

Disease

smoking cessation;GAD

Disease

Adiponectin levels;NHGRI

External Links

Links to Entrez Gene

1012

Links to all GeneRIF Items

1012

Links to iHOP

1012

Sequence Information

Nucleotide Sequence

>1012 : length: 2142
atgcagccgagaactccgctcgttctgtgcgttctcctgtcccaggtgctgctgctaaca
tctgcagaagatttggactgcactcctggatttcagcagaaagtgttccatatcaatcag
ccagctgaattcattgaggaccagtcaattctaaacttgaccttcagtgactgtaaggga
aacgacaagctacgctatgaggtctcgagcccatacttcaaggtgaacagcgatggcggc
ttagttgctctgagaaacataactgcagtgggcaaaactctgttcgtccatgcacggacc
ccccatgcggaagatatggcagaactcgtgattgtcggggggaaagacatccagggctcc
ttgcaggatatatttaaatttgcaagaacttctcctgtcccaagacaaaagaggtccatt
gtggtatctcccattttaattccagagaatcagagacagcctttcccaagagatgttggc
aaggtagtcgatagtgacaggccagaaaggtccaagttccggctcactggaaagggagtg
gatcaagagcctaaaggaattttcagaatcaatgagaacacagggagcgtctccgtgaca
cggaccttggacagagaagtaatcgctgtttatcaactatttgtggagaccactgatgtc
aatggcaaaactctcgaggggccggtgcctctggaagtcattgtgattgatcagaatgac
aaccgaccgatctttcgggaaggcccctacatcggccacgtcatggaagggtcacccaca
ggcaccacagtgatgcggatgacagcctttgatgcagatgacccagccaccgataatgcc
ctcctgcggtataatatccgtcagcagacgcctgacaagccatctcccaacatgttctac
atcgatcctgagaaaggagacattgtcactgttgtgtcacctgcgctgctggaccgagag
actctggaaaatcccaagtatgaactgatcatcgaggctcaagatatggctggactggat
gttggattaacaggcacggccacagccacgatcatgatcgatgacaaaaatgatcactca
ccaaaattcaccaagaaagagtttcaagccacagtcgaggaaggagctgtgggagttatt
gtcaatttgacagttgaagataaggatgaccccaccacaggtgcatggagggctgcctac
accatcatcaacggaaaccccgggcagagctttgaaatccacaccaaccctcaaaccaac
gaagggatgctttctgttgtcaaaccattggactatgaaatttctgccttccacaccctg
ctgatcaaagtggaaaatgaagacccactcgtacccgacgtctcctacggccccagctcc
acagccaccgtccacatcactgtcctggatgtcaacgagggcccagtcttctacccagac
cccatgatggtgaccaggcaggaggacctctctgtgggcagcgtgctgctgacagtgaat
gccacggaccccgactccctgcagcatcaaaccatcaggtattctgtttacaaggaccca
gcaggttggctgaatattaaccccatcaatgggactgttgacaccacagctgtgctggac
cgtgagtccccatttgtcgacaacagcgtgtacactgctctcttcctggcaattgacagt
ggcaaccctcccgctacgggcactgggactttgctgataaccctggaggacgtgaatgac
aatgccccgttcatttaccccacagtagctgaagtctgtgatgatgccaaaaacctcagt
gtagtcattttgggagcatcagataaggatcttcacccgaatacagatcctttcaaattt
gaaatccacaaacaagctgttcctgataaagtctggaagatctccaagatcaacaataca
cacgccctggtaagccttcttcaaaatctgaacaaagcaaactacaacctgcccatcatg
gtgacagattcagggaaaccacccatgacgaatatcacagatctcagggtacaagtgtgc
tcctgcaggaattccaaagtggactgcaacgcggcaggggccctgcgcttcagcctgccc
tcagtcctgctcctcagcctcttcagcttagcttgtctgtga

Protein Sequence

>1012 : length: 713
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKG
NDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS
LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGV
DQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQND
NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS
PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
PMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLD
RESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
VTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL



')