Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

100506658

Name

OCLN

Synonym

BLCPMG;occludin;OCLN;occludin

Definition

tight junction protein occludin

Position

5q13.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

100506658

Links to all GeneRIF Items

100506658

Links to iHOP

100506658

Sequence Information

Nucleotide Sequence

>100506658 : length: 1569
atgtcatccaggcctcttgaaagtccacctccttacaggcctgatgaattcaaaccgaat
cattatgcaccaagcaatgacatatatggtggagagatgcatgttcgaccaatgctctct
cagccagcctactctttttacccagaagatgaaattcttcacttctacaaatggacctct
cctccaggagtgattcggatcctgtctatgctcattattgtgatgtgcattgccatcttt
gcctgtgtggcctccacgcttgcctgggacagaggctatggaacttcccttttaggaggt
agtgtaggctacccttatggaggaagtggctttggtagctacggaagtggctatggctat
ggctatggttatggctatggctacggaggctatacagacccaagagcagcaaagggcttc
atgttggccatggctgccttttgtttcattgccgcgttggtgatctttgttaccagtgtt
ataagatctgaaatgtccagaacaagaagatactacttaagtgtgataatagtgagtgct
atcctgggcatcatggtgtttattgccacaattgtctatataatgggagtgaacccaact
gctcagtcttctggatctctatatggttcacaaatatatgccctctgcaaccaattttat
acacctgcagctactggactctacgtggatcagtatttgtatcactactgtgttgtggat
ccccaggaggccattgccattgtactggggttcatgattattgtggcttttgctttaata
attttctttgctgtgaaaactcgaagaaagatggacaggtatgacaagtccaatattttg
tgggacaaggaacacatttatgatgagcagccccccaatgtcgaggagtgggttaaaaat
gtgtctgcaggcacacaggacgtgccttcacccccatctgactatgtggaaagagttgac
agtcccatggcatactcttccaatggcaaagtgaatgacaagcggttttatccagagtct
tcctataaatccacgccggttcctgaagtggttcaggagcttccattaacttcgcctgtg
gatgacttcaggcagcctcgttacagcagcggtggtaactttgagacaccttcaaaaaga
gcacctgcaaagggaagagcaggaaggtcaaagagaacagagcaagatcactatgagaca
gactacacaactggcggcgagtcctgtgatgagctggaggaggactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactgtacaagaggaattttgacactggccta
caggaatacaagagcttacaatcagaacttgatgagatcaataaagaactctcccgtttg
gataaagaattggatgactatagagaagaaagtgaagagtacatggctgctgctgatgaa
tacaatagactgaagcaagtgaagggatctgcagattacaaaagtaagaagaatcattgc
aagcagttaaagagcaaattgtcacacatcaagaagatggttggagactatgatagacag
aaaacatag

Protein Sequence

>100506658 : length: 522
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT



')