Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10049

Name

DNAJB6

Synonym

DJ4|DnaJ|HHDJ1|HSJ-2|HSJ2|MRJ|MSJ-1;DnaJ (Hsp40) homolog, subfamily B, member 6;DNAJB6;DnaJ (Hsp40) homolog, subfamily B, member 6

Definition

DnaJ-like 2 protein|dnaJ homolog subfamily B member 6|heat shock protein J2

Position

7q36.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

prion pathway;PID BioCarta;100062

Disease

Breast cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

10049

Links to all GeneRIF Items

10049

Links to iHOP

10049

Sequence Information

Nucleotide Sequence

>10049 : length: 726
atggtggattactatgaagttctaggcgtgcagagacatgcctcacccgaggatattaaa
aaggcatatcggaaactggcactgaagtggcatccagataaaaatcctgagaataaagaa
gaagcagagagaaaattcaagcaagtagcggaggcatatgaagtgctgtcggatgctaag
aaacgggacatctatgacaaatatggcaaagaaggattaaatggtggaggaggaggtgga
agtcattttgacagtccatttgaatttggcttcacattccgtaacccagatgatgtcttc
agggaattttttggtggaagggacccattttcatttgacttctttgaagacccttttgag
gacttctttgggaatcgaaggggtccccgaggaagcagaagccgagggacggggtcgttt
ttctctgcgttcagtggatttccgtcttttggaagtggattttcttcttttgatacagga
tttacttcatttgggtcactaggtcacgggggcctcacttcattctcttccacgtcattt
ggtggtagtggcatgggcaacttcaaatcgatatcaacttcaactaaaatggttaatggc
agaaaaatcactacaaagagaattgtcgagaacggtcaagaaagagtagaagttgaagaa
gatggccagttaaagtccttaacaataaatggtaaggagcagctgctgcgcttggataac
aagtaa

Protein Sequence

>10049 : length: 241
MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAK
KRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFE
DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSF
GGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGKEQLLRLDN
K



')