Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

100133941

Name

CD24

Synonym

CD24A;CD24 molecule;CD24;CD24 molecule

Definition

CD24 antigen (small cell lung carcinoma cluster 4 antigen)|signal transducer CD24

Position

6q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

L1CAM interactions;PID Reactome;500097

Pathway

Axon guidance;Reactome;REACT:18266

Disease

Pre-Eclampsia;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Multiple sclerosis, susceptibility to;OMIM

Disease

Multiple sclerosis;FunDO

Disease

Congenital abnormality;FunDO

Disease

Cancer;FunDO

Disease

Temporal arteritis;FunDO

Disease

Mitral valve disease;FunDO

External Links

Links to Entrez Gene

100133941

Links to all GeneRIF Items

100133941

Links to iHOP

100133941

Sequence Information

Nucleotide Sequence

>100133941 : length: 243
atgggcagagcaatggtggccaggctcgggctggggctgctgctgctggcactgctccta
cccacgcagatttattccagtgaaacaacaactggaacttcaagtaactcctcccagagt
acttccaactctgggttggccccaaatccaactaatgccaccaccaaggcggctggtggt
gccctgcagtcaacagccagtctcttcgtggtctcactctctcttctgcatctctactct
taa

Protein Sequence

>100133941 : length: 80
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS



')