Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10013

Name

HDAC6

Synonym

HD6;histone deacetylase 6;HDAC6;histone deacetylase 6

Definition

-

Position

Xp11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

sumoylation by ranbp2 regulates transcriptional repression;PID BioCarta;100053

Disease

Breast cancer;FunDO

Disease

HIV infection;FunDO

External Links

Links to Entrez Gene

10013

Links to all GeneRIF Items

10013

Links to iHOP

10013

Sequence Information

Nucleotide Sequence

>10013 : length: 3648
atgacctcaaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctctatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcaatggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagttaaatgaattccattgcctc
tgggatgacagcttcccggaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagtgcc
caggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagaccgtggagagggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtctcgc
acagggctggtctatgaccaaaatatgatgaatcactgcaacttgtgggacagccaccac
cctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgtcac
agtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccagactatcagtgggcatgcc
ctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatgttt
gaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttcttc
cccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttcacc
gtcaacgtggcatggaacgggccccgcatgggtgatgctgactacctagctgcctggcat
cgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctcagctggc
tttgatgctgcacggggggatccgctggggggctgccaggtgtcacctgagggttatgcc
cacctcacccacctgctgatgggccttgccagtggccgcattatccttatcctagagggt
ggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctccttgga
gacccaccacccctgctgaccctgccacggcccccactatcaggggccctggcctcaatc
actgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaa
gacagagaaggaccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaa
cctaggttagctgagcggatgaccacacgagaaaagaaggttctggaagcaggcatgggg
aaagtcacctcggcatcatttggggaagagtccactccaggccagactaactcagagaca
gctgtggtggccctcactcaggaccagccctcagaggcagccacagggggagccactctg
gcccagaccatttctgaggcagccattgggggagccatgctgggccagaccacctcagag
gaggctgtcgggggagccactccggaccagaccacctcagaggagactgtgggaggagcc
attctggaccagaccacctcagaggatgctgttgggggagccacgctgggccagactacc
tcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagccatggag
ggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctgatccaa
actcctctagcctcgagcacagaccaccagacccccccaacctcacctgtgcagggaact
acaccccagatatctcccagtacactgattgggagtctcaggaccttggagctaggcagc
gaatctcagggggcctcagaatctcaggccccaggagaggagaacctactaggagaggca
gctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctcactgat
caggccatattttatgctgtgacaccactgccctggtgtccccatttggtggcagtatgc
cccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaacaatccaa
gagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaatggccac
atgctccaacaccatggaaattctggacacccgctggtcctcagctacatcgacctgtca
gcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtgaagaac
atcgcccaccagaacaagtttggggaggatatgccccacccacactaa

Protein Sequence

>10013 : length: 1215
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH



')