Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

10009

Name

ZBTB33

Synonym

ZNF-kaiso|ZNF348;zinc finger and BTB domain containing 33;ZBTB33;zinc finger and BTB domain containing 33

Definition

WUGSC:H_DJ525N14.1|kaiso transcription factor|transcriptional regulator Kaiso|zinc finger and BTB domain-containing protein 33

Position

Xq23

Gene Type

protein-coding

External Links

Links to Entrez Gene

10009

Links to all GeneRIF Items

10009

Links to iHOP

10009

Sequence Information

Nucleotide Sequence

>10009 : length: 2019
atggagagtagaaaactgatttctgctacagacattcagtactctggcagtctgctgaac
tccttgaatgagcaacgtggccatggactcttctgtgatgttaccgttattgtggaagac
cgaaaattccgggctcacaagaatattctttcagcttctagtacctacttccatcagctc
ttctctgttgctgggcaagttgttgaactgagctttataagagcagagatctttgcagaa
attctcaattatatctatagttctaaaattgttcgtgttagatcagatttgcttgatgag
ttaattaaatcagggcagttattaggagtgaaatttatagcagagcttggtgtcccattg
tcacaggttaaaagcatctcaggtacagcgcaggatggtaatactgagcctttacctcct
gattctggtgacaagaaccttgtaatacagaaatcaaaagatgaagcccaagataatggg
gctactataatgcctattataacagagtctttttcattatctgccgaagattatgaaatg
aaaaagatcattgttaccgattctgatgatgatgatgatgatgtcattttttgctccgag
attctgcccacaaaggagactttgccgagtaataacacagtggcacaggtccaatctaac
ccaggccctgttgctatttcagatgttgcacctagtgctagcaataactcgcccccttta
acaaatatcacacctactcagaaacttcctactcctgtgaatcaggcaactttgagccaa
acacaaggaagtgaaaaattgttggtatcttcagctccaacacatctgactcccaatatt
attttgttaaatcagacaccactttctacaccaccaaatgtcagttcttcacttccaaat
catatgccctcttcaatcaatttacttgtgcagaatcagcagacaccaaacagtgctatt
ttaacaggaaacaaggccaatgaagaggaggaggaggaaataatagatgatgatgatgac
actattagctccagtcctgactcggccgtcagtaatacatctttggtcccacaggctgat
acctcccaaaataccagttttgatggatcattaatacagaagatgcagattcctacactt
cttcaagaaccactttccaattccttaaaaatttcagatataattactagaaatactaat
gatccaggcgtaggatcaaaacatctaatggagggtcagaagatcattactttagataca
gctactgaaattgaaggcttatcgactggttgcaaggtttatgcaaatatcggtgaagat
acttatgatatagtgatccctgtcaaagatgaccctgatgaaggggaggccagacttgag
aatgaaataccaaaaacgtctggcagcgagatggcaaacaaacgtatgaaagtaaaacat
gatgatcactatgagttaatagtagatggaagggtctattatatctgtattgtatgcaaa
aggtcatatgtctgtctgacaagcttgcggagacattttaacattcattcttgggagaag
aagtatccgtgccgttactgtgagaaggtatttcctcttgcagaatatcgcacaaagcat
gaaattcatcacacaggggagcgaaggtatcagtgtttggcctgtggcaaatctttcatc
aactatcagtttatgtcttcacatataaagtcagttcatagtcaagatccttctggggac
tcaaagctttatcgtttacatccatgcaggtctttacaaatcagacaatatgcatatctt
tccgatagatcaagcactattcctgcaatgaaggatgatggtattgggtataaggttgac
actggaaaagaacctccagtagggaccactacatctactcagaacaagccaatgacctgg
gaagatatttttattcagcaggaaaatgattcaatttttaaacaaaatgtaacagatggc
agtactgagtttgaatttataataccagagtcttactaa

Protein Sequence

>10009 : length: 672
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEM
KKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISDVAPSASNNSPPL
TNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPN
HMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQAD
TSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDT
ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKH
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH
EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
SDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY



')